100 Notable alumni of
Emerson College
Updated:
Emerson College is 338th in the world, 142nd in North America, and 135th in the United States by aggregated alumni prominence. Below is the list of 100 notable alumni from Emerson College sorted by their wiki pages popularity. The directory includes famous graduates and former students along with research and academic staff.
-
Brandon Lee
- Occupations
- actorfilm actorThai boxertelevision actormartial artist
- Biography
-
Brandon Bruce Lee was an American actor. Establishing himself as a rising action star in the early 1990s, he landed what was to be his breakthrough role as Eric Draven in the supernatural superhero film The Crow (1994). However, Lee's career and life were cut short by his accidental death during the film's production.
-
Jennifer Coolidge
- Occupations
- actorfilm actortelevision actorcharacter actorvoice actor
- Biography
-
Jennifer Coolidge is an American actress. Known for her work in the comedy genre, Coolidge is the recipient of several accolades, including a Golden Globe Award and two Primetime Emmy Awards. In 2023, she was included in the annual Time 100 list of the most influential people in the world.
-
Paul Thomas Anderson
- Occupations
- directorscreenwriterwriterproducerfilm producer
- Biography
-
Paul Thomas Anderson, also known by his initials PTA, is an American filmmaker. His accolades include a BAFTA Award, and nominations for 11 Academy Awards and three Golden Globe Awards. He has also won Best Director at the Cannes Film Festival, the Silver Lion at the Venice Film Festival, and the Silver and Golden Bear at the Berlin Film Festival.
-
Henry Winkler
- Occupations
- writertelevision directorfilm produceractorstage actor
- Biography
-
Henry Franklin Winkler is an American actor, author, director, and producer. Widely known as Arthur "Fonzie" Fonzarelli on the sitcom Happy Days, Winkler has distinguished himself as a character actor for roles on stage and screen. His many accolades include three Emmy Awards, two Golden Globe Awards and two Critics Choice Awards.
-
Bill Burr
- Enrolled in Emerson College
- In 1993 graduated with bachelor's degree
- Occupations
- screenwriterwriterfilm actorpodcastertelevision actor
- Biography
-
William Frederick Burr is an American stand-up comedian, actor, writer, and podcaster. He has released multiple stand-up comedy specials, including You People Are All the Same (2012), I'm Sorry You Feel That Way (2014), Walk Your Way Out (2017), and Paper Tiger (2019).
-
Jay Leno
- Occupations
- stand-up comedianscreenwritertelevision actoractorYouTuber
- Biography
-
James Douglas Muir Leno is an American television host, comedian, and writer. After doing stand-up comedy for years, he became the host of NBC's The Tonight Show from 1992 until 2009 when Conan O'Brien took over as host. Beginning in September 2009, Leno started a primetime talk show, The Jay Leno Show, which aired weeknights at 10:00 p.m. ET, also on NBC. O'Brien turned down NBC's offer to have Leno host a half hour monologue show before The Tonight Show to boost ratings amid reported viewership diminishing, which sparked the 2010 Tonight Show conflict that resulted in Leno's returning to hosting the show on March 1, 2010. He hosted his last episode of his second tenure on February 6, 2014. That year, he was inducted into the Television Hall of Fame. From 2014 to 2022, he hosted Jay Leno's Garage, and from 2021 to 2023, hosted the revival of You Bet Your Life.
-
Gina Gershon
- Occupations
- screenwriterfilm directorsingervoice actorstage actor
- Biography
-
Gina L. Gershon is an American actress and singer. She has starred in such films as Cocktail (1988), Red Heat (1988), Showgirls (1995), Bound (1996), Face/Off (1997), The Insider (1999), Demonlover (2002), P.S. I Love You (2007), Five Minarets in New York (2010), Killer Joe (2011), and House of Versace (2013). She has also had supporting roles in FX's Rescue Me and HBO's How to Make It in America. She also portrayed Jughead's mom Gladys Jones on The CW teen drama series Riverdale and Lauren Bloom's mother Jeanie Bloom on the NBC medical series New Amsterdam.
-
David Cross
- Occupations
- television producersingerstage actorfilm directorcomedian
- Biography
-
David Cross is an American stand-up comedian, actor, writer, and director. Cross is best known for his stand-up performances, the HBO sketch comedy series Mr. Show with Bob and David (1995–1998), and his role as Tobias Fünke in the Fox/Netflix sitcom Arrested Development (2003–2006, 2013–2019). He has been described as “one of the defining figures of cult Gen X comedy”.
-
Kerem Bürsin
- Occupations
- film actormodelproduceractor
- Biography
-
Kerem Bürsin is a Turkish actor, known for his work predominantly in films, television and streaming series. After graduating from Emerson College in Marketing Communications Department, Bürsin began his acting career. He gained fame with the role in the TV shows Güneşi Beklerken (2013−2014) and Şeref Meselesi (2014−2015). Bürsin received attention after playing Ali Smith in romance action series Bu Şehir Arkandan Gelecek (2017) for which he won Seoul International Drama Awards for Best Actor.
-
Iliza Shlesinger
- Occupations
- film actorscreenwritertelevision actortelevision presenteractor
- Biography
-
Iliza Vie Shlesinger is an American stand-up comedian, actress and television host. She was the 2008 winner of NBC's Last Comic Standing and went on to host the syndicated dating show Excused from 2011 to 2013. She has hosted the TBS game show Separation Anxiety.
-
Denis Leary
- Occupations
- showrunnertelevision actorfilm actoruniversity teachertelevision producer
- Biography
-
Denis Colin Leary is an American stand-up comedian and actor. Born in Massachusetts, Leary first came to prominence as a stand-up comedian, especially through appearances on MTV (including the comedic song "Asshole") and through the stand-up specials No Cure for Cancer (1993) and Lock 'n Load (1997). Leary began taking roles in film and television starting in the 1990s, including substantial roles in the films Judgment Night (1993), Gunmen (1994), Operation Dumbo Drop (1995) and Wag the Dog (1997).
-
Maria Menounos
- Occupations
- television presenterfilm actorfilm directorbeauty pageant contestantjournalist
- Biography
-
Maria Menounos is an American television host. She has hosted Extra and E! News; she was a TV correspondent for Today, Access Hollywood, and co-hosted the Eurovision Song Contest 2006 in Athens, Greece. She also co-created and is currently CEO of online podcast series network AfterBuzz TV. She is currently signed to WWE where she has served as an ambassador since 2013, having even competed in some tag team events as a pro since 2009. She hosted the podcast Conversations with Maria Menounos. She also co-hosted Miss Universe 2023 pageant on November 18, 2023.
-
Norman Lear
- Occupations
- television producerscreenwriterbusinesspersonfilm producerfilm director
- Biography
-
Norman Milton Lear was an American screenwriter and producer who produced, wrote, created, or developed over 100 shows. Lear created and produced numerous popular 1970s sitcoms, including All in the Family (1971–1979), Maude (1972–1978), Sanford and Son (1972–1977), One Day at a Time (1975–1984), The Jeffersons (1975–1985), and Good Times (1974–1979). His shows introduced political and social themes to the sitcom format.
-
Joely Fisher
- Occupations
- stage actorsingeractortelevision actorfilm actor
- Biography
-
Joely Fisher is an American actress and singer, the daughter of singer Eddie Fisher and actress Connie Stevens, and half-sister of actress Carrie Fisher. Her breakthrough came in 1994, starring as Paige Clark in the ABC sitcom Ellen, for which she was nominated for a Golden Globe Award for Best Supporting Actress in a Series, Miniseries or Television Film at the 55th Golden Globe Awards. Fisher later starred in the 1999 comedy film Inspector Gadget and had leading roles in the Lifetime comedy-drama Wild Card (2003–2005), and Fox sitcom 'Til Death (2006–2010).
-
Abbi Jacobson
- Occupations
- voice actorscreenwriterfilm actorpodcasterfilm director
- Biography
-
Abbi Jacobson is an American comedian, actress, writer, producer, and illustrator. She co-created and co-starred in the Comedy Central series Broad City (2014–2019) with Ilana Glazer, based on the web series of the same name. Her other roles include voicing Katie Mitchell in The Mitchells vs. the Machines (2021), Nya in The Lego Ninjago Movie (2017), and Princess Bean in the series Disenchantment (2018–2023), in addition to appearing in the live-action films Person to Person (2017) and 6 Balloons (2018). She is a writer and co-creator of the Amazon Prime series A League of Their Own (2022), in which she also stars as Carson Shaw, a baseball player in the All-American Girls Professional Baseball League.
-
Natasha Gregson Wagner
- Occupations
- film actoractortelevision actor
- Biography
-
Natasha Gregson Wagner is an American actress. She is the daughter of film producer Richard Gregson and actress Natalie Wood. She has appeared in films including Lost Highway, Two Girls and a Guy, First Love, Last Rites (all 1997), Urban Legend, Another Day in Paradise (both 1998) and High Fidelity (2000).
-
Andrea Martin
- Occupations
- film actorscreenwriterstage actortelevision actorvoice actor
- Biography
-
Andrea Louise Martin is an American and Canadian actress, best known for her work in the television series SCTV and Great News. She has appeared in films such as Black Christmas (1974), Wag the Dog (1997), Hedwig and the Angry Inch (2001), My Big Fat Greek Wedding (2002), My Big Fat Greek Wedding 2 (2016), Little Italy (2018) and My Big Fat Greek Wedding 3 (2023). She has also lent her voice to the animated films Anastasia (1997), The Rugrats Movie (1998), and Jimmy Neutron: Boy Genius (2001). Since 2021, she co-stars in the supernatural drama series Evil. She is currently playing a recurring role on Only Murders in the Building (2021).
-
Elden Henson
- Occupations
- film actoractortelevision actor
- Biography
-
Elden Henson is an American actor. He is best known for playing Fulton Reed in The Mighty Ducks trilogy (1992–1996), Foggy Nelson in Daredevil (2015–2018) and four other Marvel Cinematic Universe television series, and Pollux in The Hunger Games: Mockingjay - Part 1 (2014) and Part 2 (2015).
-
Steven Wright
- Occupations
- screenwriterfilm directortelevision actorwritercomedian
- Biography
-
Steven Alexander Wright is an American stand-up comedian, actor, writer, and film producer. He is known for his distinctive lethargic voice and slow, deadpan delivery of ironic, philosophical and sometimes nonsensical jokes, paraprosdokians, non sequiturs, anti-humor, and one-liners with contrived situations.
-
Michael Nouri
- Occupations
- film actortelevision actorstage actoractor
- Biography
-
Michael Nouri is an American screen and stage actor. He is best known for his television roles, including Dr. Neil Roberts on The O.C., Phil Grey on Damages, Caleb Cortlandt on All My Children, Eli David in NCIS, and Bob Schwartz on Yellowstone. He is also known for his starring roles in the films Flashdance (1983) and The Hidden (1987), and has appeared in several Broadway and Off-Broadway plays, including the original production of Victor/Victoria. He is a Saturn Award and Daytime Emmy Award nominee.
-
Cazzie David
- Years
- 1994-.. (age 31)
- Occupations
- screenwriterfilm directoractor
- Biography
-
Cazzie Laurel David is an American scriptwriter and actress. David co-created and co-starred in the web series Eighty-Sixed (2017). Her first collection of essays No One Asked For This was released in 2020. She also appears in the third season of Netflix's The Umbrella Academy.
-
Joanna Going
- Occupations
- film actoractortelevision actor
- Biography
-
Joanna Catherine Going is an American actress known for the television series Kingdom, House of Cards, Mad Men and the movie Wyatt Earp.
-
Wishnutama
- Occupations
- journalistcreative directorchief executive officer
- Biography
-
Wishnutama Kusubandio is a former Indonesian journalist and businessman. He was co-founder and CEO of NET. Mediatama Television, from founding on 18 May 2013 until his resignation on 22 October 2019. He served as Minister of Tourism and Creative Economy under Joko Widodo between 23 October 2019 and 22 December 2020. His deputy minister before being called off was Angela Tanoesoedibjo.
-
Bobbi Brown
- Occupations
- businesspersonmake-up artist
- Biography
-
Bobbi Brown is an American professional make-up artist, author, and the founder of Bobbi Brown Cosmetics. She created ten natural-shade lipsticks which according to Entrepreneur "revolutionized the beauty industry". She has written nine books about beauty and wellness.
-
May Calamawy
- Occupations
- actorperforming artist
- Biography
-
May El Calamawy is an Egyptian-Palestinian actress who has worked and resided in the United States since 2015. She is known for her roles in the American television series Ramy (2019–present) as Dena Hassan, and Moon Knight (2022) as Layla El-Faouly / Scarlet Scarab, the first Arab and first Egyptian character and superhero in the Marvel Cinematic Universe.
-
Mario Cantone
- Occupations
- film actoractortelevision actor
- Biography
-
Mario Cantone is an American comedian, writer, actor, singer and television host best known for his numerous stage shows. He also played Anthony Marentino in Sex and the City and Terri in Men in Trees (2006–2008). He hosted children's television program Steampipe Alley, which aired on WWOR-TV from 1988 to 1993. His style is fast-paced and energetic, with much of his humor coming from his impersonations of characters ranging from family members to celebrities to stereotypes.
-
Dan Levy
- Occupations
- actorscreenwritertelevision actorwritershowrunner
- Biography
-
Daniel Levy is an American comedian, actor, writer, and producer based in Los Angeles. He began performing stand-up in the 2000s and has released three comedy albums, including his most recent special Dan Levy: Lion in 2016. He has written for a number of television comedies including Whitney (2011–2013) and was a producer of The Awesomes (2013–2015), Mulaney (2014–15), and The Goldbergs (2014–15). In 2020, he created the NBC series Indebted.
-
Dan Finnerty
- Occupations
- singeractor
- Biography
-
Dan Finnerty is an American actor and singer.
-
Benjamin Bronfman
- Occupations
- entrepreneurmusician
- Biography
-
Benjamin Zachary Bronfman is an American businessman and musician. Bronfman is a founding partner and board member of Global Thermostat, a direct air capture company that removes carbon dioxide from the atmosphere.
-
Hartley Sawyer
- Occupations
- film actoractortelevision actor
- Biography
-
Hartley Sawyer is an American former actor. He played Brian Sommers on the short-lived TBS series Glory Daze (2010–2011), Kyle Abbott on the CBS Daytime soap opera The Young and the Restless (2013–2014), and Ralph Dibny / Elongated Man on The CW series The Flash (2017–2020).
-
Paul Dini
- Occupations
- television producerscreenwritercomics artistwriterblogger
- Biography
-
Paul McClaran Dini is an American screenwriter and comic creator. He has been a producer and writer for several Warner Bros. Animation/DC Comics animated series, most notably Batman: The Animated Series (1992–1995), and the subsequent DC Animated Universe. Dini and Bruce Timm co-created the characters Harley Quinn and Terry McGinnis.
-
Justin Willman
- Occupations
- actorstage magician
- Biography
-
Justin Willman is an American magician, comedian, producer, and television personality. He is the creator and star of Magic for Humans on Netflix. The third season of Magic for Humans was released on May 15, 2020. He has made regular appearances on The Tonight Show, The Ellen DeGeneres Show, and Conan. His debut comedy/magic special Sleight of Mouth premiered on Comedy Central in 2015. He hosts the shows Cupcake Wars, Halloween Wars, King of Cones on the Food Network, Disney's Win, Lose or Draw on Disney Channel, along with Baking Impossible and The Magic Prank Show with Justin Willman on Netflix.
-
Pearl Aday
- Years
- 1975-.. (age 50)
- Enrolled in Emerson College
- Studied creative writing
- Occupations
- singerfilm producer
- Biography
-
Pearl Aday is an American singer. She is the adopted daughter of vocalist Michael Lee Aday, better known as Meat Loaf, and was a member of his touring band Neverland Express for nine years starting in the mid-1990s. She has appeared on numerous albums and in various tours and television performances with her father, both as backing singer and in duets. She has also been a backing singer for Mötley Crüe. She is currently the lead singer of her own band "Pearl" and has released her debut album on Megaforce/RED/Sony Music on January 19, 2010. Aday also co-organized the hard rock group Motor Sister with her husband Scott Ian, singing backing vocals.
-
Lori Alan
- Occupations
- film actortelevision actorvoice actorstage actor
- Biography
-
Lori Alan is an American actress. She has played a long-running role as Pearl Krabs on the animated television series SpongeBob SquarePants. She also voiced Diane Simmons on Family Guy, the Invisible Woman on Fantastic Four, and The Boss in the Metal Gear video game series.
-
Seth Grahame-Smith
- Occupations
- film producermanufacturerscreenwriternovelisttelevision producer
- Biography
-
Seth Grahame-Smith is an American writer and film producer, best known as the author of The New York Times best-selling novels Pride and Prejudice and Zombies and Abraham Lincoln, Vampire Hunter, both of which have been adapted as feature films. Grahame-Smith is also the co-creator, head writer and executive producer of The Hard Times of RJ Berger, a scripted television comedy appearing on MTV. In collaboration with David Katzenberg, his partner in Katzsmith Productions, Grahame-Smith is currently developing a number of projects for television and film.
-
Richard Dysart
- Occupations
- film actortelevision actorstage actoractor
- Biography
-
Richard Allen Dysart was an American actor. He is best known for his role as senior partner Leland McKenzie in the television series L.A. Law (1986–1994), for which he won a 1992 Primetime Emmy Award as Outstanding Supporting Actor in a Drama Series after four consecutive nominations. In film, he held supporting roles in The Hospital (1971), Being There (1979), The Thing (1982), Mask (1985), Pale Rider (1985) and Wall Street (1987).
-
Princess Noor bint Asem Al-Hashem
- Biography
-
Princess Noor bint Asem is a member of the Jordanian royal family.
-
Adam Green
- Occupations
- singer-songwritercomposeractorvisual artistfilm producer
- Biography
-
Adam Green is an American singer-songwriter, artist and filmmaker.
-
George Watsky
- Occupations
- writerpoetrecording artistrapper
- Biography
-
George Virden Watsky is an American rapper, singer, songwriter, record producer, poet, author, and illustrator.
-
Sophiko Shevardnadze
- Occupations
- television presenterradio personalityfilm producermanufacturerjournalist
- Biography
-
Sophie Paatovna Shevardnadze (Russian: София (Софико) Паатовна Шеварднадзе; Georgian: სოფო შევარდნაძე, born 23 September 1978) is a Georgian/Russian journalist, presenter, author and producer. She is the creator and executive producer of the show Simply Complicated on the platform Yandex.Efir, Russia's equivalent of Google. She is the host of SophieCo Visionaries, and between 2006 and 2015 she was a presenter on the radio station Echo of Moscow.
-
Spencer Tunick
- Occupations
- photographer
- Biography
-
Spencer Tunick is an American photographer best known for organizing large-scale nude shoots.
-
Jessie Ward
- Occupations
- professional wrestlertelevision producer
- Biography
-
Jessie Lynn Whitney is an American television producer and retired professional wrestler.
-
Kevin S. Bright
- Occupations
- film produceractorscreenwritertelevision directoruniversity teacher
- Biography
-
Kevin S. Bright is an American television executive producer and director. He is best known as the showrunner of the sitcoms Dream On and Friends.
-
Emily Skeggs
- Occupations
- stage actorsingeractor
- Biography
-
Emily Skeggs is an American actress and singer. She was nominated for the Tony Award for Best Featured Actress in a Musical in 2015 for playing the role of Medium Alison in Fun Home.
-
Glenn Branca
- Occupations
- composerluthierguitarist
- Biography
-
Glenn Branca was an American avant-garde composer, guitarist, and luthier. Known for his use of volume, alternative guitar tunings, repetition, droning, and the harmonic series, he was a driving force behind the genres of no wave, totalism and noise rock. Branca received a 2009 Foundation for Contemporary Arts Grants to Artists Award.
-
Nicola Yoon
- Occupations
- writer
- Biography
-
Nicola Yoon /ˈnɪkələ/ is a Jamaican-American author. She is best known for writing the 2015 young adult novel Everything, Everything, a New York Times best seller and the basis of a 2017 film of the same name. In 2016, she released The Sun Is Also a Star, a novel that was adapted to a 2019 film of the same name.
-
Michael Angelakos
- Occupations
- singerauthorrecord producerguitaristcomposer
- Biography
-
Michael John Angelakos is an American musician, singer, songwriter, and record producer. He is best known as the frontman of the indietronica band Passion Pit.
-
Adele Lim
- Years
- 1975-.. (age 50)
- Occupations
- film or television directortelevision producerscreenwriterfilm producer
- Biography
-
Adele Lim is a Malaysian screenwriter, producer, and director. She is best known for being a co-writer on Crazy Rich Asians, the first film by a major Hollywood studio to feature a majority cast of Asian descent in a modern setting since The Joy Luck Club in 1993, and Raya and the Last Dragon in 2021, an animated fantasy adventure inspired by Southeast Asian culture. She also directed and produced the 2023 comedy Joy Ride.
-
Bill Dana
- Occupations
- musicianscreenwritertelevision actoractor
- Biography
-
William Szathmary, known as Bill Dana, was an American comedian, actor, and screenwriter. He often appeared on television shows such as The Ed Sullivan Show, frequently in the guise of a heavily accented Bolivian character named José Jiménez. Dana often portrayed the Jiménez character as an astronaut.
-
Joe Mande
- Occupations
- screenwriterstand-up comedianactor
- Biography
-
Joseph Mande is an American stand-up comedian, writer, and actor.
-
Eugene Roche
- Occupations
- stage actoractortelevision actor
- Biography
-
Eugene Harrison Roche was an American actor and the original "Ajax Man" in 1970s television commercials.
-
Rosebud Baker
- Occupations
- comedian
- Biography
-
Rosemary "Rosebud" Baker is an American comedian, actress, and writer. Based in New York City, she is known for her dark humor based on personal, often satirical stories. In 2010, She worked as an actress in independent films, non-union television projects, and off-Broadway. She later began appearing in a recurring role on the Hulu series Life & Beth. Baker started her career in stand-up in 2014 by performing at open mics throughout New York City. In 2021, her debut comedy special, Whiskey Fists, premiered on Comedy Central. She became a writer for the HBO Max television series That Damn Michael Che in 2020 and a writer for Saturday Night Live in 2022.
-
Mary Kay Adams
- Occupations
- stage actorfilm actortelevision actor
- Biography
-
Mary Kay Adams is an American actress. She is best knowing for playing the roles of India von Halkein on the CBS soap opera Guiding Light (1984 to 1987, return appearances from 1990 to 2005) and Na'Toth on the science fiction television series Babylon 5 (1994 to 1995). She also had a recurring role as Grilka on Star Trek: Deep Space Nine (1994 and 1996).
-
Mike Joy
- Occupations
- sports commentator
- Biography
-
Michael Kinsey Joy is an American TV sports announcer and businessman who serves as the play-by-play commentator for Fox Sports' NASCAR coverage. His color analysts are Clint Bowyer and Kevin Harvick. Joy has been part of the live broadcast crew for 45 Daytona 500s. He also serves as expert analyst for A&E Networks History Channel and FYI live TV coverage of collector car auctions.
-
Veronica Belmont
- Occupations
- audio engineerpodcasterengineerjournalist
- Biography
-
Veronica Ann Belmont is an American online media personality. She was formerly the co-host of the Revision3 show Tekzilla alongside Patrick Norton. Belmont was the co-host of the former TWiT.tv gaming show Game On! along with Brian Brushwood, and the former host of the monthly PlayStation 3-based video on demand program Qore. Additionally, she was the host for the Mahalo Daily podcast and a producer and associate editor for CNET Networks, Inc. where she produced, engineered, and co-hosted the podcast Buzz Out Loud.
-
Anthony Atamanuik
- Years
- 1974-.. (age 51)
- Occupations
- writeractorcomedian
- Biography
-
Anthony Atamanuik is an American writer, actor, and comedian. He impersonated former U.S. President Donald Trump during the campaign and his presidency, first on the Trump vs. Bernie debate tour, and then on The President Show.
-
Kōtarō Tatsumi
- Occupations
- film criticpolitician
- Biography
-
Kotaro Tatsumi is a member of the House of Councillors and a member of the Japanese Communist Party. He was elected to his position in the National Diet in 2013. Tatsumi is opposed to the MagLev system, saying that it is a waste of resources.
-
Penny Peyser
- Occupations
- film actortelevision actorfilm directoractor
- Biography
-
Penelope Allison "Penny" Peyser is an American actress, writer, and filmmaker.
-
Jamie Loftus
- Enrolled in Emerson College
- Studied in 2014
- Occupations
- screenwriterwriterpodcastercomedianperformance artist
- Biography
-
Jamie Bethany Loftus is an American writer, stand up alternative comedian, animator, podcast co-host, and actor based in Los Angeles. She is known for her solo work, such as her one-woman shows I Lost My Virginity on August 15, 2010 and Boss, Whom is Girl. She has also written comedic articles, and written and starred in video content, for media sites such as Adult Swim, Comedy Central, Paste, and Super Deluxe. She was nominated for an Emmy for her work on Robot Chicken in 2020.
-
Eric Hutchinson
- Occupations
- singer-songwritersinger
- Biography
-
Eric Hutchinson is an American singer-songwriter best known for his songs "Rock & Roll", "OK, It's Alright with Me", "Not There Yet", "Watching You Watch Him", and "Tell the World". Hutchinson was named an AOL "About to Pop" artist, Yahoo! Who's Next Artist, MSN "One to Watch" Artist and a "VH1 You Oughta Know" Artist. Hutchinson also wrote and performed the theme song for ESPN's Fantasy Focus podcast.
-
Alex Tse
- Occupations
- screenwriter
- Biography
-
Alex Tse is an American screenwriter and television show creator active since 2004. He was one of the creators and executive producers of the 2019 TV series Wu-Tang: An American Saga. Prior to that, Tse wrote the 2004 gangster film Sucker Free City, co-wrote the 2009 superhero film Watchmen, and wrote the 2018 film Superfly.
-
Olen Steinhauer
- Occupations
- writernovelist
- Biography
-
Olen Steinhauer is an American writer of spy fiction novels, including The Tourist, part of the Milo Weaver series, and the Yalta Boulevard Sequence. Steinhauer also created the TV series Berlin Station, focused on a fictional Central Intelligence Agency branch operating in Berlin, which began airing in 2016.
-
Donzaleigh Abernathy
- Occupations
- film actorwritertelevision actoractor
- Biography
-
Donzaleigh Abernathy is an American actress, author and civil rights activist.
-
Vin Di Bona
- Occupations
- television producer
- Biography
-
Vincent John "Vin" Di Bona is an American television producer of the television shows MacGyver, Entertainment Tonight, America's Funniest Home Videos and Dancing with the Stars. He runs an eponymous production company called Vin Di Bona Productions. In 2010, Di Bona launched a second business, FishBowl Worldwide Media, an independent production company developing properties for film, television, digital platforms and brands.
-
Paul Kreppel
- Occupations
- theatrical directortelevision actortelevision directoractor
- Biography
-
Paul Kreppel is an American actor and director. On television, he was best known as pianist Sonny Mann on the show It's a Living. In his work as theater director-producer-creator, he received the 2007 Tony Award for Jay Johnson: The Two and Only.
-
Justin Chou
- Occupations
- politician
- Biography
-
Chou Shou-hsun is a Taiwanese politician who served in the Legislative Yuan from 2005 to 2012. He is known in English as Justin Chou.
-
Morgan Page
- Occupations
- musiciandisc jockeycomposerrecord producer
- Biography
-
Morgan Wolf Page is an American DJ and music producer. His tracks include "The Longest Road", "Fight for You" and "In the Air". Page has received two Grammy Award nominations; a personal nomination for best remix with Nadia Ali and in 2009 his song was nominated for best remix; "The Longest Road" (deadmau5 Remix). Page is signed to Armada Music worldwide.
-
Philip Ettinger
- Enrolled in Emerson College
- Studied film directing
- Occupations
- film actoractortelevision actor
- Biography
-
Philip Ettinger is an American actor. He first gained attention for his supporting role as the troubled environmental activist, Michael, in Paul Schrader's First Reformed (2017). Other significant roles have been as Garrett Drimmer in the CBS All Access series One Dollar (2018), as the young-adult version of Mark Ruffalo's twin characters, Dominick and Thomas Birdsey, in HBO's I Know This Much Is True in 2020, and in the lead role of Cole Freeman in Braden King's cinematic adaptation of the Carter Sickels' novel The Evening Hour (2020).
-
Sam Doumit
- Occupations
- stage actorfilm actortelevision actor
- Biography
-
Samia "Sam" Doumit is an American actress.
-
Jason Scott
- Enrolled in Emerson College
- Studied in 1992
- Occupations
- media historianpodcasterfilm directorarchivist
- Biography
-
Jason Scott Sadofsky is an American archivist, historian of technology, filmmaker, performer, and actor. Scott has been known by the online pseudonyms Sketch, SketchCow, Sketch The Cow, The Slipped Disk, and textfiles. He has been called "the figurehead of the digital archiving world".
-
Chris Hurst
- Occupations
- politicianactivistnews presenterjournalist
- Biography
-
Christopher Laird Hurst is an American journalist, former news anchor and former member of the Virginia House of Delegates for the state's 12th district.
-
Todd Strauss-Schulson
- Occupations
- film producerscreenwriterfilm directorcinematographerfilm editor
- Biography
-
Todd Strauss-Schulson is an American film director, screenwriter, producer, editor, and cinematographer, best known for directing the comedy film A Very Harold & Kumar 3D Christmas (2011), the horror comedy film The Final Girls (2015), and the romantic comedy film Isn't It Romantic (2019). He has also directed episodes of the television series The Inbetweeners (2012) and Zach Stone Is Gonna Be Famous (2013).
-
Rob Laakso
- Occupations
- composermusicianrecord producer
- Biography
-
Rob Laakso was an American musician, record producer and engineer, best known as the recording partner of indie rock musician Kurt Vile and as a multi-instrumentalist in his backing band the Violators. Laakso also played in the shoegaze band Swirlies, among others. Born in Massachusetts in 1979, Laakso graduated from Emerson College.
-
Lisi Harrison
- Occupations
- writerchildren's writer
- Biography
-
Elyse E. "Lisi" Harrison is a Canadian novelist of young adult fiction, known for the three series The Clique, Alphas and Monster High.
-
Danny Ledonne
- Occupations
- film directorfilm producer
- Biography
-
Danny A. Ledonne is an American film director and former video game developer. From 2011 to 2014, he worked as a professor in Film and Media Arts at American University, served on the board of the Southern Colorado Film Commission, and became the director for the 2015 edition of the festival. He is known for the documentary Playing Columbine, about the controversy surrounding his 2005 video game Super Columbine Massacre RPG!.
-
Doug Herzog
- Biography
-
Doug Herzog is an American television executive. He was formerly the president of Viacom Music and Entertainment Group, he oversaw MTV, VH1, Logo TV, Comedy Central, Palladia, TV Land and Spike. Herzog has been credited with evolving the MTV brand by steering the network away from music related programming.
-
Alicyn Packard
- Occupations
- voice actorfilm director
- Biography
-
Alicyn Packard is an American voice actress, writer, singer and retired stand-up comedian nominated for a 2014 Voice Arts Award. As of 2004–2005, she provided the voice of Bulb from Disney Channel's Magnet-Tude. She also voices the characters Little Miss Sunshine, Little Miss Naughty, and Little Miss Whoops on the Cartoon Network animated series The Mr. Men Show. She also stars as Cadet Robyn on the Sprout network show Space Racers and as Alma on the Sprout network show The Extraordinary Adventures of Poppy Cat and wrote an episode of the show's second season. She plays Toodles on The Tom and Jerry Show, and Connor and Caitlin on Olivia. She also played Jibanyan on Yo-kai Watch.
-
Jack Gantos
- Occupations
- writerchildren's writernovelist
- Biography
-
Jack Gantos is an American author of children's books. He is best known for the fictional characters Rotten Ralph and Joey Pigza. Rotten Ralph is a cat who stars in twenty picture books written by Gantos and illustrated by Nicole Rubel from 1976 to 2014. Joey Pigza is a boy with attention-deficit hyperactivity disorder (ADHD), featured in five novels from 1998 to 2014.
-
Doris Haddock
- Occupations
- political activistpolitician
- Biography
-
Doris "Granny D" Haddock was an American political activist from New Hampshire. Haddock achieved national fame when, between the ages of 88 and 90, starting on January 1, 1999, and culminating on February 29, 2000, she walked over 3,200 miles (5,100 km) across the continental United States to advocate for campaign finance reform. In 2004, she ran unsuccessfully as a Democratic challenger to incumbent Republican Judd Gregg in the U.S. Senate election in New Hampshire.
-
Morton Dean
- Occupations
- journalist
- Biography
-
Morton Dean Dubitsky, better known as Morton Dean, is an American television and radio anchor, news correspondent and author.
-
Gerry Duggan
- Occupations
- writercomics writerscreenwriter
- Biography
-
Gerry Duggan is an American comics writer, director and photographer living in Los Angeles.
-
Ben Collins
- Occupations
- journalist
- Biography
-
Ben Collins is an American businessman and journalist from Massachusetts. He was a former reporter for the news division of the National Broadcasting Company, and became the CEO of the media company Global Tetrahedron, which owns The Onion, in 2024.
-
Elaine Noble
- Occupations
- politician
- Biography
-
Elaine Noble is an American politician and LGBT activist who served in the Massachusetts House of Representatives for two terms starting in January 1975. She was the first openly lesbian or gay candidate elected to a state legislature. She served two terms as representative for the Fenway-Kenmore and Back Bay neighborhoods of Boston.
-
Michael Rulli
- Enrolled in Emerson College
- Studied in 1991
- Occupations
- businesspersonpolitician
- Biography
-
Michael Anthony Rulli is an American politician, musician and businessman who is serving as the U.S. representative for Ohio's 6th congressional district. He previously served as an Ohio State Senator for the 33rd district from 2019 until June 12, 2024. He is a member of the Republican Party.
-
Bill Schulz
- Years
- 1975-.. (age 50)
- Occupations
- journalist
- Biography
-
William Dawes Schulz is an American journalist, writer, and television personality. Schulz was the host of Mornin'!!! with Bill Schulz and Joanne Nosuchinsky on Compound Media, and is best known for being on the Fox News late-night show Red Eye w/ Greg Gutfield. Schulz is also a freelance writer and a former senior editor of Stuff Magazine.
-
Gabe Dunn
- Years
- 1988-.. (age 37)
- Enrolled in Emerson College
- In 2009 studied multimedia journalism
- Occupations
- television producernovelistYouTuberpodcasterfilm director
- Biography
-
Gabriel Shane Dunn is an American writer, podcaster, actor, and filmmaker. Since 2014, Dunn has hosted the YouTube comedy show and podcast Just Between Us with fellow former BuzzFeed writer Allison Raskin. Dunn also hosts the podcast Bad with Money, which launched in 2016 and which primarily focuses on personal finances, while also discussing subjects including poverty and economic oppression. Their debut young adult novel I Hate Everyone but You, co-authored with Raskin, was published in 2017 and made The New York Times Best Seller list. Dunn has also published two finance-related books, as well as a graphic novel. They were formerly a writer, director, and performer for BuzzFeed Video before leaving to focus on Just Between Us.
-
Hussein Ibish
- Occupations
- journalist
- Biography
-
Hussein Yusuf Kamal Ibish is a senior resident scholar at the Arab Gulf States Institute in Washington. He is a weekly columnist for The National (UAE), former columnist for Bloomberg, regular contributor to The Atlantic and The Daily Beast, and frequent contributor to many other U.S. and Middle Eastern publications. He has made thousands of radio and television appearances and was the Washington, DC correspondent for The Daily Star (Beirut). Many of Ibish's articles are archived on his Ibishblog website.
-
Suzan Johnson Cook
- Occupations
- pastorpoliticianwritertelevision producer
- Biography
-
Suzan Denise Johnson Cook is a U.S. presidential advisor, pastor, theologian, author, activist, and academic who served as the United States Ambassador-at-Large for International Religious Freedom from April 2011 to October 2013. She has served as a policy advisor to President Bill Clinton and later to the Secretary of Housing and Urban Development Henry Cisneros, a dean and professor of communications at Harvard University, a professor of theology at New York Theological Seminary, a pastor at a number of churches, a television producer, and the author of nearly a dozen books. She was the first female senior pastor in the 200-year history of the Mariners Temple Baptist Church in NYC part of the American Baptist Churches USA and a close friend of Coretta Scott King. She is an honorary member of Delta Sigma Theta sorority.
-
Louise Closser Hale
- Occupations
- film actorwriterstage actornovelist
- Biography
-
Louise Closser Hale was an American actress, playwright and novelist.
-
Alice Moore Hubbard
- Occupations
- writer
- Biography
-
Alice Moore Hubbard was a noted American feminist, writer. She and her husband, Elbert Hubbard, were leading figures in the Roycroft movement, a branch of the Arts and Crafts Movement in England with which it was contemporary. Moore Hubbard served as the general manager for the collective, along with managing the Roycraft Inn. She was also the principal of Roycroft School for Boys.
-
Kizzy
- Occupations
- presentertelevision presentersingeractortelevision actor
- Biography
-
Kizzy Yuanda Constance Getrouw is a Dutch actress, singer and television host who performs mononymously as Kizzy. She became a household name in the Netherlands Antilles with hit songs and TV shows. In the United States, she presented TV shows on both The Gossip Swapp on XY TV and CN8. Her best known poems are Supervrouwen and Cel Voor Cel. Kizzy currently presents kids TV shows.
-
Jaclyn Friedman
- Years
- 1971-.. (age 54)
- Occupations
- activistsex educatorwriterpodcasterorator
- Biography
-
Jaclyn Friedman is an American feminist writer and activist known as the co-editor (with Jessica Valenti) of Yes Means Yes: Visions of Sexual Power and a World Without Rape and Believe Me: How Trusting Women Can Change the World, the writer of Unscrewed: Women, Sex, Power and How to Stop Letting the System Screw Us All and What You Really Really Want: The Smart Girl’s Shame-Free Guide To Sex and Safety, the founder and Executive Director of EducateUS, an organization focused on building a movement of voters laser-focused on advancing sex education across the country. She is also a campus speaker on issues of feminism, sexual freedom and anti-rape activism, and the founder and former executive director of Women, Action & The Media.
-
Charles Wesley Emerson
- Years
- 1837-1908 (aged 71)
- Occupations
- Christian minister
- Biography
-
Charles Wesley Emerson was the founder, namesake and first president of Emerson College in Boston, Massachusetts. Charles Emerson was also a minister with the Unitarian Church and the author of a number of books dealing with oratory.
-
Laura van den Berg
- Years
- 1983-.. (age 42)
- Occupations
- writernovelist
- Biography
-
Laura van den Berg is an American fiction writer. She is the author of five works of fiction. Her first two collections of short stories were each shortlisted for the Frank O'Connor International Short Story Award, in 2010 and 2014. In 2021, she was awarded the Strauss Livings Award from the American Academy of Arts & Letters and a Guggenheim Fellowship.
-
Kathleen Rooney
- Occupations
- novelistessayist
- Biography
-
Kathleen Rooney is an American writer, publisher, editor, and educator.
-
Thomas Lux
- Occupations
- poet
- Biography
-
Thomas Lux was an American poet who held the Margaret T. and Henry C. Bourne, Jr. Chair in Poetry at the Georgia Institute of Technology and ran Georgia Tech's "Poetry @ Tech" program. He wrote fourteen books of poetry.
-
Don Lee
- Occupations
- novelist
- Biography
-
Don Lee is an American novelist, fiction writer, literary journal editor, and creative writing professor.
-
Peter O'Brian
- Occupations
- film directorassistant directorfilm producer
- Biography
-
Peter O'Brian is a Canadian film producer and broadcast executive. Films produced by O'Brian's company, Independent Pictures, have won nineteen Genie Awards. His production credits include Blood and Guts, The Grey Fox, Outrageous!, John and the Missus, Milk and Honey and My American Cousin.
-
Rachel Louise Snyder
- Occupations
- journalist
- Biography
-
Rachel Louise Snyder is an American journalist, writer, and professor. She has written about domestic violence and worked as a foreign correspondent for the public radio program Marketplace, and also contributed to All Things Considered and This American Life. She is a professor in the Department of Literature at American University.
-
Marion Fairfax
- Occupations
- screenwriterwriterplaywrightfilm producerfilm director
- Biography
-
Marion Fairfax was an American screenwriter, playwright, actress, and producer.
