74 Notable alumni of
Obafemi Awolowo University
Updated:
Obafemi Awolowo University is 766th in the world, 17th in Africa, and 4th in Nigeria by aggregated alumni prominence. Below is the list of 74 notable alumni from Obafemi Awolowo University sorted by their wiki pages popularity. The directory includes famous graduates and former students along with research and academic staff.
-
Fatou Bensouda
- Occupations
- politiciandiplomatlawyer
- Biography
-
Fatou Bom Bensouda is a Gambian lawyer and former Prosecutor of the International Criminal Court (ICC), who has served as the Gambian High Commissioner to the United Kingdom since 3 August 2022.
-
Asake
- Enrolled in Obafemi Awolowo University
- Graduated with Bachelor of Arts in theater arts
- Occupations
- musiciansingersongwriter
- Biography
-
Ahmed Ololade, known professionally as Asake, is a Nigerian singer, rapper and songwriter. He was previously signed to YBNL Nation and Empire Distribution. His stage name "Asake" is his mother's name.
-
Great edwin
- Occupations
- film actorsingerphilanthropist
- Biography
-
Omotola Jalade Ekeinde Listen, MFR is a Nigerian actress, singer, philanthropist and former model. Since her Nollywood film debut in 1995, Ekeinde has appeared in over 300 films, selling millions of copies. Omotola is the second Nigerian and first Nigerian celebrity to receive over 1 million likes on her Facebook page. She currently has a total of 3 million followers on Facebook.
-
Fireboy DML
- Occupations
- singer-songwriter
- Biography
-
Adedamola Oyinlola Adefolahan, known professionally as Fireboy DML, is a Nigerian singer and songwriter. In 2018, he signed a record deal with YBNL Nation, a record label founded by rapper Olamide. His debut studio album, Laughter, Tears and Goosebumps, was released in 2019. He won Listener's Choice and was nominated for Song of the Year for "Jealous" at the 2020 Soundcity MVP Awards Festival. His third studio album, Playboy, entered the Billboard 200 at number 123. His latest album, Adedamola, was released in 2024.
-
Akinwumi Adesina
- Occupations
- politiciancivil servantagricultural economisteconomist
- Biography
-
Akinwumi Adesina CON is a Nigerian economist, who is currently serving as the President of the African Development Bank. He previously served as Nigeria's Minister of Agriculture and Rural Development. Until his appointment as Minister in 2010, he was Vice President of Policy and Partnerships for the Alliance for a Green Revolution in Africa. He was elected as the President of the African Development Bank in 2015 and re-elected for a second term in 2020. He is the first Nigerian to hold the post.
-
Stella Obasanjo
- Occupations
- politicianactivist
- Biography
-
Stella Obasanjo was the First Lady of Nigeria from 1999 until her death. She was the wife of former President Olusegun Obasanjo, although she was not the First Lady in 1976, when Obasanjo was military head of state. She died while undergoing elective liposuction abroad.
-
Femi Falana
- Occupations
- Senior Advocate of Nigeriahuman rights activistlawyer
- Biography
-
Femi Falana, SAN is a Nigerian lawyer and human right activist. He is the father of a Nigerian rapper Folarin Falana popularly known as Falz.
-
Dele Momodu
- Occupations
- politicianjournalistchief executive officerbusinesspersonmotivational speaker
- Biography
-
Chief Dele Momodu is a Nigerian journalist, publisher, businessman, and motivational speaker. He is the CEO and publisher of Ovation International, a celebrity magazine. In 2015, he officially launched Ovation TV and subsequently launched an online newspaper called The Boss Newspaper. Momodu has received hundreds of awards and honors for his work in the world of business, politics, literature, the music industry and the fashion industry. He writes a weekly column called "Pendulum", published every Saturday on the back page of ThisDay newspaper. The articles have been praised for highlighting topical national issues in Nigeria, as well as discussing popular topics, current events and notable people, often in a polemic/critical style.
-
Mark Angel
- Occupations
- screenwritercomediantelevision producer
- Biography
-
Mark Angel is a Nigerian scriptwriter and YouTuber. He is best known for the Mark Angel Comedy series of shorts on YouTube, often featuring child comedians such as his cousin, Emmanuella Samuel (age 14), his niece, and her cousin "Aunty" Success Madubuike (age 16). Angel's YouTube channel was the first African comedy (Afrocomedy) channel to reach one million subscribers. Mark Angel has a wife who also acts within his productions with his fellow actors, which are Mr. Azu, Baze10, Ebere, The Law, Mimi, Kingsley Brown.
-
Dapo Abiodun
- Occupations
- businesspersonpolitician
- Biography
-
Adedapo Oluseun Abiodun MFR CON is a Nigerian businessman and politician, who has served as Governor of Ogun State since May 2019. Currently a member of the All Progressive Congress, Abiodun first entered politics during the aborted Abacha transition in 1998 and remained active in politics until being elected governor in 2019.
-
Abayomi Olonisakin
- Occupations
- military personnel
- Biography
-
Abayomi Gabriel Olonisakin CFR psc GSS CMH fwc (born 2 December 1961) is a retired Nigerian Army general, former Chief of Defence Staff, and current Nigerian Ambassador to the Republic of Cameroon. He was appointed to the position of Chief of Defence Staff on 13 July 2015 by President Muhammadu Buhari. He resigned from office on 29 January 2021.
-
Blaqbonez
- Occupations
- songwriterrapperartistsinger
- Biography
-
Emeka Akumefule, known professionally as Blaqbonez, is a Nigerian rapper and singer signed to Chocolate City.
-
Biyi Bandele
- Occupations
- film directorfilmmakerplaywrightscreenwriterwriter
- Biography
-
Biyi Bandele was a Nigerian novelist, playwright and filmmaker. He was the author of several novels, beginning with The Man Who Came in From the Back of Beyond (1991), as well as writing stage plays, before turning his focus to filmmaking. His directorial debut was in 2013 with Half of a Yellow Sun, based on the 2006 novel of the same name by Chimamanda Ngozi Adichie.
-
Olukayode Ariwoola
- Years
- 1958-.. (age 67)
- Occupations
- lawyer
- Biography
-
Olukayode Ariwoola GCON is a Nigerian jurist and justice of the Supreme Court of Nigeria who served as the chief justice of the Federal Republic of Nigeria from 2022 to 2024. He was formerly a justice of the Nigerian courts of appeal and on 22 November 2011, he was appointed to the bench of the supreme court of Nigeria. He was appointed substantive chief justice of Nigeria on 27 June 2022 following the resignation of former chief justice Tanko Muhammad and formally confirmed chief justice by the Nigerian Senate on 21 September 2022.
-
Olusegun Mimiko
- Years
- 1954-.. (age 71)
- Enrolled in Obafemi Awolowo University
- Studied in 1972-1976
- Occupations
- politician
- Biography
-
Olusegun Rahman Mimiko, is a Nigerian medical doctor and politician who served as governor of Ondo State from 2009 to 2017. He was the senatorial candidate of the Zenith Labour Party for Ondo Central District in the 2019 Senate elections. He served as the 16th (5th civilian) governor of Ondo State, becoming the first two-term governor of Ondo State, and the first Labour Party governor in Nigeria. Mimiko was previously a federal minister for housing and urban development, a secretary to the Ondo State Government, and a two-time Ondo State Commissioner for Health.
-
Abike Dabiri
- Occupations
- journalistpolitician
- Biography
-
Abike Kafayat Oluwatoyin Dabiri-Erewa OON is a Nigerian politician and former member of the Nigeria Federal House of Representatives representing Ikorodu Constituency in Lagos State. She was the Chairman of the House Committee on Media & Publicity.
-
Adebayo Adelabu
- Occupations
- politician
- Biography
-
Adebayo Adelabu Listen is a former deputy governor, operations of the Central Bank of Nigeria and currently serving as the federal minister of power of Nigeria. He was also an Oyo State gubernatorial candidate for the All Progressives Congress in 2019.
-
Olagunsoye Oyinlola
- Occupations
- politician
- Biography
-
Ọlagunsoye Oyinlọla is a retired Nigerian general, he became governor of Osun State, Nigeria in May 2003, and was reelected in 2007. He was a member of the ruling Peoples Democratic Party (PDP).
-
Jimi Agbaje
- Occupations
- pharmacistpolitician
- Biography
-
Olujimi Kolawole Agbaje, popularly known as Jimi Agbaje; (born 2 March 1957), is a Nigerian politician who has unsuccessfully contested for the governor of Lagos State for four consecutive times, between 2007 and 2019.
-
Olajumoke Olufunmilola Adenowo
- Occupations
- entrepreneurarchitectwriter
- Biography
-
Olajumoke Olufunmilola Adenowo is a Nigerian architect. She started her own architecture and interior design firm, AD Consulting, in 1994.
-
Ayobami Adebayo
- Occupations
- writernovelist
- Biography
-
Ayọ̀bámi Adébáyọ̀ is a Nigerian writer. Her 2017 debut novel, Stay With Me, won the 9mobile Prize for Literature and the Prix Les Afriques. She was awarded The Future Awards Africa Prize for Arts and Culture in 2017.
-
Aderounmu Adejumoke
- Enrolled in Obafemi Awolowo University
- Graduated with Bachelor of Arts in international relations
- Occupations
- actor
- Biography
-
Adejumoke Aderounmu was a Nigerian actress. She is best known for playing roles like Esther And Kelechi in the popular Nollywood TV series Jenifa's Diary and Industreet, Jummy Adams in Nollywood's film Alakada 2 (2013) alongside Funke Akindele, Toyin Abraham, Odunlade Adekola, Linda Ejiofor, Falz, Juliana Olayode, and Lolo1.
-
Toyin Falola
- Enrolled in Obafemi Awolowo University
- In 1976 graduated with Bachelor of Arts
- In 1981 graduated with Doctor of Philosophy
- Occupations
- writeruniversity teacherhistorian
- Biography
-
Toyin Omoyeni Falola is a Nigerian historian and professor of African Studies. Falola is a Fellow of the Historical Society of Nigeria and of the Nigerian Academy of Letters, and has served as the president of the African Studies Association. He is currently the Jacob and Frances Sanger Mossiker Chair in the Humanities at the University of Texas at Austin.
-
Mike Ozekhome
- Occupations
- oratorconstitutional lawyerhuman rights activist
- Biography
-
Mike Agbedor Abu Ozekhome is a lawyer and human rights activist, holding the rank of a Senior Advocate of Nigeria. He is known for his work as a constitutional lawyer and also an orator.
-
Oscar N. Onyema
- Years
- 1968-.. (age 57)
- Occupations
- managing director
- Biography
-
Oscar N. Onyema OON, is the immediate past Group Chief Executive Officer of Nigerian Exchange Group Plc (formerly known as the Nigerian Stock Exchange), an institution that services the largest economy in Africa and champions the development of Africa’s financial markets. Prior to attaining this position, he was the CEO of The Nigerian Stock Exchange (“NSE”) for 10 years. He has widely been recognized as an agent of change in restoring and growing investors’ confidence and advancing Nigeria’s capital markets towards a path of sustainable growth and development. Onyema is the Chairman of two affiliate companies: Central Securities Clearing System Plc (CSCS), the clearing, settlement, and depository for the Nigerian capital market; and NG Clearing Limited, which is the premier Central Counter Party Clearing House (CCP) in Nigeria. He serves on several other boards and committees domestically and internationally including the Pension Commission of Nigeria (PENCOM), London Stock Exchange Group (LSEG) Africa Advisory Group (LAAG), and Membership Committee of the WFE. He served for over 20 years in United States financial markets and the Nigerian information technology sector.
-
Akin Lewis
- Occupations
- screenwriterfilm directorfilm produceractor
- Biography
-
Akin LewisListen is a Nigerian film actor, director, and producer.
-
Otobong Nkanga
- Occupations
- photographerdraftspersonvisual artistperforming artistpainter
- Biography
-
Otobong Nkanga is a Nigerian-born visual artist, tapestry maker and performance artist, based in Antwerp, Belgium. In 2015, she won the Yanghyun Prize.
-
Bisi Adeleye-Fayemi
- Occupations
- founderLeadership Coaching As Identity Workwriteractivistphilanthropist
- Biography
-
Bisi Adeleye-Fayemi is a Nigerian-British feminist activist, policy advocate, social change philanthropy practitioner and writer.
-
Funke Opeke
- Occupations
- engineer
- Biography
-
Funke Opeke is a Nigerian electrical engineer, founder of Main Street Technologies and Chief Executive Officer of Main One Cable Company, a communications services company based in Lagos State, south-western Nigeria.
-
Chinko Ekun
- Enrolled in Obafemi Awolowo University
- Graduated with Bachelor of Laws
- Occupations
- songwriterlawyerrappersinger
- Biography
-
Oladipo Olamide Emmanuel, known professionally as Chinko Ekun, is a Nigerian rapper and songwriter. He is a graduate of Law from the Obafemi Awolowo University.
-
Oluwatoyin Ogundipe
- Years
- 1960-.. (age 65)
- Occupations
- writerlectureracademic
- Biography
-
Oluwatoyin Temitayo Ogundipe is a Nigerian academic and a professor of botany. He served as the 12th vice chancellor of the University of Lagos from November 2017 to November 2022.
-
Yusuf Sulaimon Lasun
- Occupations
- engineerpolitician
- Biography
-
Yusuf Sulaimon Lasun is a Nigerian politician who served as the deputy speaker of the House of Representatives of Nigeria from 2015 to 2019. He represented Irepodun/Olurunda/Osogbo/Orolu Federal Constituency of Osun State in the House.
-
Godwin Abbe
- Occupations
- politician
- Biography
-
Godwin Osagie Abbe was a Nigerian Army Major General who served as minister of defence from 2009 to 2010. He also served as minister of interior from 2007 to 2009.
-
Folasade Ogunsola
- Years
- 1958-.. (age 67)
- Occupations
- researcher
- Biography
-
Folasade Tolulope Ogunsola OON is a Nigerian professor of medical microbiology, and the Vice-Chancellor of the University of Lagos. She specializes in disease control, particularly HIV/AIDS. Ogunsola was provost of College of Medicine, University of Lagos and the first woman to occupy the position. She was also the Deputy Vice Chancellor (Development Services) of the institution between 2017 and 2021. She was acting vice chancellor of the University of Lagos for a short period in 2020 when the university was plunged into crisis as a result of the removal of the Vice Chancellor by the University Council.
-
MC Lively
- Occupations
- comedianactor
- Biography
-
Michael Sani Amanesi, known by his stage name MC Lively is a Nigerian comedian and actor from Agenebode, Edo State, south-south Nigeria.
-
Olanrewaju Fagbohun
- Occupations
- writerlawyeracademic
- Biography
-
Olanrewaju Adigun Fagbohun SAN is a Nigerian lawyer, academic, author, investor, professor of environmental law, regulations, and a Senior Advocate of Nigeria. He served as the 8th substantive vice-chancellor of Lagos State University between 11 January 2016 to 10 January 2021. His administration as LASU's vice chancellor witnessed tremendous gains in research, innovations and infrastructural development – which helped to propel the university from obscurity to the second best university in Nigeria according to the 2021 Times Higher Education ranking. He was appointed by the governor of Lagos State, Akinwunmi Ambode to succeed professor John Obafunwa, a Nigerian pathologist whose tenure ended on 31 October 2015. His appointment was lauded by the Lagos State University chapter of the Academic Staff Union of Universities. The association through the chapter chairman pledge their full support for good administration.
-
Adewole Adebayo
- Years
- 1972-.. (age 53)
- Occupations
- politician
- Biography
-
Adewole Adebayo is a Nigerian Lawyer and Founder of KAFTAN TV.
-
Juliet Ehimuan
- Born in
-
Nigeria - Occupations
- entrepreneur
- Biography
-
Dr Juliet Ehimuan is a Nigerian business leader, technology executive, and social entrepreneur. She is the founder of Beyond Limits Africa. In June 2023, she stepped down from her role as Director at Google West Africa where she had spent 12 years.
-
Ibiyinka Alao
- Occupations
- painterarchitect
- Biography
-
Ibiyinka Olufemi Alao is an American artist, architect, writer, film director and musical theater composer. He has focused his career on the fluidity of all art forms, using painting as an act of frozen music and self-expression. Along with John Lennon and 3 other artists, he is noted among 5 Artists Who Have Spread Messages of Peace Around the World by Global Citizen.
-
Woli Arole
- Years
- 1990-.. (age 35)
- Occupations
- businesspersonactorcomedian
- Biography
-
Woli Arole is a Nigerian comedian, actor and on-air personality. Professionally he is called Arole, Woli Arole.
-
Dapo Akande
- Occupations
- academiclawyer
- Biography
-
Dapo Akande is a British-Nigerian academic and lawyer. Akande is the Chichele Professor of Public International Law at the University of Oxford, a Fellow of All Souls College, Oxford and co-director of the Oxford Institute for Ethics, Law and Armed Conflict. Akande was the first Black professor to be honoured with a portrait at St Peter's College, Oxford. Akande is a founding editor of EJIL:Talk!, the scholarly blog of the European Journal of International Law.
-
Ambrose Olutayo Somide
- Born in
- Nigeria
- Occupations
- radio personality
- Biography
-
Ambrose Olutayo Somide is a Nigerian TV/Radio presenter. He studied Urban and Regional Planning at the University of Ife in Ife, Nigeria. Somide works as Managing Director Radio Services at DAAR Communications Plc (DCP) and is the originator of Faaji FM.
-
Sam Nda-Isaiah
- Occupations
- columnist
- Biography
-
Samuel Ndanusa Isaiah, commonly known as Sam Nda-Isaiah, was a Nigerian political columnist, pharmacist, entrepreneur and journalist. He was the founder and chairman of the Leadership Newspaper.
-
Olayemi Ogunwole
- Occupations
- radio personalitytelevision presenter
- Biography
-
Olayemi Ogunwole popularly known as Honey Pot is a radio and TV host with TVC Communications, Lagos, Nigeria.
-
Emmanuel Iduma
- Occupations
- novelist
- Biography
-
Emmanuel Iduma is a Nigerian writer and art critic. He is the author of A Stranger's Pose (2018) and Farad (2012). In 2016, Farad was republished in North America as The Sound of Things to Come. He was awarded the inaugural Irving Sandler Award for New Voices in Art Criticism by the Association Internationale des Critiques d’Art, USA. He teaches in the MFA Art Writing Program at the School of Visual Arts, New York City.
-
Olúfẹ́mi Táíwò
- Occupations
- university teacherphilosopher
- Biography
-
Olúfẹ́mi Táíwò is a philosopher and professor of African political thought at the Africana Studies Research Center at Cornell University. He was born in Nigeria, where he lived most of his life except for five years in Canada.
-
Bola Akindele
- Occupations
- banker
- Biography
-
Adebola Ismail Akindele is a Nigerian entrepreneur, business strategist and philanthropist. He is the Group Managing Director of Courteville Business Solutions, a provider of information technology, consulting, and business process outsourcing services. He is a member of the board of advisors of the East Africa Business Network (EABN). He was recognized as one of the "21 Nigerian tech CEOs at the top of their game" by the African Business Central magazine.
-
Yemisi Adedoyin Shyllon
- Years
- 1952-.. (age 73)
- Occupations
- engineerart collectorlawyer
- Biography
-
Yemisi Adedoyin Shyllon is a prince of Ake in Abeokuta, Ogun State, Nigeria. He hails from the Sogbulu and Ogunfayo lineage of the Laarun ruling house of Ake in Egbaland.
-
Ayo Ayoola-Amale
- Occupations
- ombudsmanpoetlawyer
- Biography
-
Ayo Ayoola-Amale is a Nigerian poet and lawyer born in Jos, Nigeria.
-
Adebayo Adewusi
- Years
- 1958-.. (age 67)
- Occupations
- academiceconomist
- Biography
-
Adebayo Ismail Adewusi is a Nigerian academic, lawyer, public administrator, politician and twice a former Commissioner in Lagos state. He was appointed commissioner for Finance between the year 2004 to 2006 and later as commissioner for Budget and Planning. He was also a governorship aspirant in Oyo State, Nigeria. In December 2019, Adewusi succeeded Barrister Bisi Adegbuyi as the Postmaster General and CEO of Nigerian Postal Service (NIPOST) by the administration of President Muhammadu Buhari He was later replaced by the incumbent Tola Odeyemi in October 2023 by the administration of President Bola Tinubu
-
Wole Oguntokun
- Years
- 1967-2024 (aged 57)
- Enrolled in Obafemi Awolowo University
- Graduated with Bachelor of Laws
- Occupations
- lawyerfilm director
- Biography
-
Wole Oguntokun was a Nigerian playwright, dramaturge, director and was the artistic director of Theatre Planet Studios and Renegade Theatre as well as a member of the board of Theaturtle, a Canadian theatre company. He was also a theatre administrator and newspaper columnist.
-
Ibukun Odusote
- Occupations
- civil servant
- Biography
-
Ibukun Odusote is a Nigerian civil servant in IT and administration. She was the first administrative contact person for the.ng top level Nigerian domain name. She has served as the Permanent Secretary for the Nigerian Federal Ministry of Agriculture and Rural Development and for the Political Affairs Department in the Office of the Secretary to the Federal Government.
-
Gbenga Shobo
- Occupations
- banker
- Biography
-
Gbenga Francis Shobo is currently Deputy Managing Director, First Bank of Nigeria Limited; prior to which, he was Executive Director, Retail Banking with the bank. A chartered accountant, Gbenga began his career with Coopers & Lybrand, a firm of chartered accountants, in 1986. Thereafter, he joined Victory Merchant Bank, commencing a career in banking that has spanned 23 years.
-
Femi Robinson
- Occupations
- actortelevision actor
- Biography
-
Femi Robinson Listen was a Nigerian film and television actor, famous for his lead role in The Village Headmaster, where his stage name, "Ife Araba, The Village Headmaster", was coined. Chief Eddie Ugbomah, former Chairman of the Nigerian Film Corporation, called him "an icon of the industry".
-
Victor Ekpuk
- Years
- 1964-.. (age 61)
- Occupations
- painterartist
- Biography
-
Victor Ekpuk is a Nigerian-born artist based in Washington, DC. Ekpuk came to prominence through his paintings and drawings, which reflect indigenous African philosophies of the Nsibidi and Uli art forms.
-
Dapo Olorunyomi
- Occupations
- journalist
- Biography
-
Oyedapo Oyekunle "Dapo" Olorunyomi, is a Nigerian journalist. He is the publisher and editor-in-chief of Premium Times, an online Nigerian newspaper. He is also the chief executive officer of the Centre for Journalism Innovation and Development (CJID). He was the policy director and chief of staff to the executive chairman of the Economic and Financial Crimes Commission (EFCC).
-
Rotimi Babatunde
- Years
- 20th Century
- Occupations
- playwright
- Biography
-
Rotimi Babatunde is a Nigerian writer and playwright.
-
Bolaji Owasanoye
- Years
- 1963-.. (age 62)
- Occupations
- lawyerhuman rights activist
- Biography
-
Bolaji Olufunmileyi Owasanoye is a Nigerian lawyer and human rights activist. He currently serves as the Chairman of the Independent Corrupt Practices and other Related Offences Commission, ICPC, an anticorruption agency in Nigeria.
-
Ernest Ojukwu
- Years
- 1960-.. (age 65)
- Occupations
- university teacherjuristlawyer
- Biography
-
Ernest Maduabuchi Ojukwu, is a past Deputy Director-General and Head of Campus of the Nigerian Law School, Augustine Nnamani Campus, Agbani Enugu. Before his appointment, he was Associate Professor and Dean Faculty of Law, Abia State University, Uturu from 1995-2001. He is also the President of the Network of University Legal Aid Institutions (NULAI Nigeria), the platform through which he has continued to achieve his dreams of promoting clinical legal education and reform of legal education in Nigeria.
-
Oluwatoyin Sanni
- Occupations
- writerchief executive officerpastor
- Biography
-
Oluwatoyin Sanni or Toyin Sanni is a Nigerian investment banker, lawyer, chartered secretary, stockbroker, and author. In June 2018, she resigned from United Capital. where she was Group CEO for over four years and in July 2018, she became the CEO of Emerging Africa Capital
-
Gbenga Elegbeleye
- Years
- 1964-.. (age 61)
- Occupations
- politician
- Biography
-
Gbenga Elegbeleye Listen is a Nigerian sports administrator and a politician. Gbenga Elegbeleye is the Director-General of the National Sports Commission in Nigeria. He was a legislator in the House of Representatives (Nigeria).
-
John Michael Ogidi
- Years
- 1959-.. (age 66)
- Occupations
- military personnel
- Biography
-
John Michael Ogidi is a retired Nigerian Army major general. He was Defence Adviser of the Nigeria High Commission in the United Kingdom from March 2012 to March 2015 and until his retirement in July 2015, he was the Commander Corps of Signal Headquarters Nigerian Army Signals.
-
Akin Fayomi
- Occupations
- diplomat
- Biography
-
Ambassador Akin Fayomi is a Nigerian career diplomat who was the Minister/Head of Political Affairs at the High Commission of Nigeria, London from July 2004 to March 2007. Later he was Ambassador and Special Representative of the Chairperson of the African Union Commission (SRCC) to Liberia from January 2010 to July 2011. He was then appointed as Under-Secretary in the Ministry of Foreign Affairs from July 2011 to July 2012, before his appointment as The Ambassador of Nigeria to France from July 2012 to December 2013. He was also appointed as the first Nigerian Ambassador to the Principality of Monaco during the same period.
-
Kunle Adewale
- Occupations
- businesspersonpaintersocial entrepreneur
- Biography
-
Olakunle Joel Adewale is a Nigerian social entrepreneur and visual artist who in 2013 founded Tender Arts Nigeria, an organization with focus on therapeutic arts, arts in health, talent development, community empowerment and civic engagement through visual, literary and performing arts which benefit children, youth, adult and the aged across the world. Also, on 10 October 2021, he launched the first ever Mental health fellowship where he helps amplify the voices of young people interested in mental health and that with also provides a form of mental healing to the fellows.
-
Adepeju Jaiyeoba
- Years
- 1983-.. (age 42)
- Occupations
- businessperson
- Biography
-
Adepeju Opeyemi Jaiyeoba is a Nigerian social entrepreneur and activist who created the Brown Button Foundation as well as Mother's Delivery Kit which creates low cost health care options and delivery kits containing basic sterile supplies for expectant mothers in Nigeria.
-
Abdur-Raheem Adebayo Shittu
- Years
- 1953-.. (age 72)
- Occupations
- writer
- Biography
-
Abdur-Raheem Adebayo Shittu is a Nigerian lawyer and politician who served as minister of communications of Nigeria from 2015 to 2019. Before becoming minister, he had earlier served as a member of the Oyo State House of Assembly, becoming the youngest Honourable member at age 26, to take the office.
-
Razack Adeyemi Adeola
- Years
- 1959-.. (age 66)
- Occupations
- business executive
- Biography
-
Razack Adeyemi Adeola is a Nigerian banker notable for winning the 2014 Business Day (Nigeria) Outstanding CEO Award and the 2015 The Sun (Nigeria) Banker of the Year.
-
Bamidele A Ojo
- Occupations
- political scientist
- Biography
-
Bamidele Adesegun Ojo is a Nigerian and American political scientist, author and professor emeritus of political science and international studies at Fairleigh Dickinson University, Teaneck, New Jersey, USA.
-
Abiola Segun
- Born in
- Nigeria
- Occupations
- screenwriterpresenteractor
- Biography
-
Abiola Segun-Williams is a Nigerian actress, TV presenter, and scriptwriter best known for her role as Titi K in TV soap opera, Tinsel.
-
Samuel Segun Okoya
- Years
- 1958-.. (age 67)
- Occupations
- academic
- Biography
-
Samuel Segun Okoya is an academic in applied mathematics at Obafemi Awolowo University. He is the editor-in-chief of the Journal and Notices of the Nigerian Mathematical Society and the First Occupier of Pastor E.A Adeboye Outstanding Professor of Mathematics (Endowed Professorial Chair) University of Lagos. He is the alumnus to attain the position of professor and head of the Mathematics Department at Obafemi Awolowo University.
-
Ituen Basi
- Occupations
- fashion designer
- Biography
-
Ituen Bassey trading as Ituen Basi is a Nigerian fashion designer. She has created costume designs for musical theatre as well as creating catwalk shows. She has worked in the UK and in Nigeria.
-
Muhammad Banaru Abubakar
- Years
- 1939-2015 (aged 76)
- Biography
-
Muhammad Banaru Abubakar was a Nigerian Administrator and public servant.
-
Babalola Chinedum Peace
- Years
- 20th Century
- Occupations
- university teacherVice-chancelloracademic
- Biography
-
Chinedum Peace Babalola FAS, FAAS is a Nigerian Professor of Pharmaceutical chemistry and Pharmacokinetics. She teaches pharmacy at the University of Ibadan, FAS, and FAAS and served as vice-chancellor of Chrisland University from 2023 to 2024.
-
Bunmi Dipo Salami
- Occupations
- politicianwomen's rights activisthuman rights activist
- Biography
-
Bunmi Dipo-Salami is a Nigeria-born feminist, development strategist and social entrepreneur. She is the Chief Executive at PLEG Centre, a company that helps to enhance the capacity of leaders in Nigeria and across Africa. She is the Nigeria Country Coordinator for Townhall Radio.
