100 Notable alumni of
University of East Anglia
Updated:
The University of East Anglia is 331st in the world, 114th in Europe, and 26th in the United Kingdom by aggregated alumni prominence. Below is the list of 100 notable alumni from the University of East Anglia sorted by their wiki pages popularity. The directory includes famous graduates and former students along with research and academic staff.
-
Matt Smith
- Enrolled in the University of East Anglia
- Studied in 2002-2005
- Occupations
- actorfilm actorstage actortelevision actoraccountant
- Biography
-
Matthew Robert Smith is an English actor. He is known for playing the Eleventh Doctor in the BBC science fiction television series Doctor Who (2010–2014), Prince Philip in Netflix's historical series The Crown (2016–2017)—for which he received a Primetime Emmy Award nomination—and Daemon Targaryen in HBO's fantasy drama series House of the Dragon (2022–present).
-
John Rhys-Davies
- Occupations
- film actortelevision actorstage actoractor
- Biography
-
John Rhys-Davies is a Welsh actor best known for portraying Gimli in The Lord of the Rings trilogy and Sallah in the Indiana Jones franchise. He has received three Screen Actors Guild Award nominations, with one win, and a Primetime Emmy Award nomination.
-
Kazuo Ishiguro
- Enrolled in the University of East Anglia
- 1979-1980 studied Master of Arts
- Occupations
- screenwriterwriternovelistscience fiction writerlyricist
- Biography
-
Sir Kazuo Ishiguro is a Japanese-born British novelist, screenwriter, musician, and short-story writer. He is one of the most critically acclaimed contemporary fiction authors writing in English, having been awarded the 2017 Nobel Prize in Literature. In its citation, the Swedish Academy described Ishiguro as a writer "who, in novels of great emotional force, has uncovered the abyss beneath our illusory sense of connection with the world".
-
Jack Davenport
- Occupations
- film produceractorfilm actorstage actortelevision actor
- Biography
-
Jack Arthur Davenport is an English actor. He is best known for his roles in the television series This Life and Coupling, and as James Norrington in the Pirates of the Caribbean series. He has also appeared in other Hollywood films, such as The Talented Mr. Ripley and Kingsman: The Secret Service.
-
Ian McEwan
- Enrolled in the University of East Anglia
- In 1971 graduated with Master of Arts
- Occupations
- screenwriterwriterplaywrightfilm screenwriternovelist
- Biography
-
Ian Russell McEwan CH CBE FRSA FRSL is a British novelist and screenwriter. In 2008, The Times featured him on its list of "The 50 greatest British writers since 1945" and The Daily Telegraph ranked him number 19 in its list of the "100 most powerful people in British culture".
-
James Frain
- Occupations
- stage actorfilm directoractortelevision actorfilm actor
- Biography
-
James Frain is an English actor. His best known television roles include Thomas Cromwell in the Showtime/CBC historical drama The Tudors, Franklin Mott in the HBO drama True Blood (2010), Warwick the Kingmaker in the BBC drama serial The White Queen (2013), John Sumner in the Sky/Canal+ crime drama The Tunnel (2013), Ferdinand Chevalier in the BBC/Space sci-fi thriller Orphan Black (2015–2017), Theo Galavan/Azrael in Fox's Gotham (2015–2016), and Sarek in Star Trek: Discovery (2017–2019).
-
Paul Whitehouse
- Occupations
- screenwritertelevision actoractorcomedian
- Biography
-
Paul Julian Whitehouse is a Welsh actor, writer, presenter and comedian. He was one of the main stars of the BBC sketch comedy series The Fast Show and has starred with Harry Enfield in the shows Harry & Paul and Harry Enfield & Chums. He has appeared with Bob Mortimer in the BBC series Mortimer & Whitehouse: Gone Fishing and has also acted in films including Corpse Bride (2005), Alice in Wonderland (2010) and The Death of Stalin (2017).
-
John Boyne
- Occupations
- short story writerwriterchildren's writerjournalist
- Biography
-
John Boyne is an Irish novelist. He is the author of sixteen novels for adults, six novels for younger readers, two novellas and one collection of short stories. His novels are published in over 50 languages. His 2006 novel The Boy in the Striped Pyjamas was adapted into a 2008 film of the same name.
-
Tupou VI of Tonga
- Years
- 1959-.. (age 66)
- Occupations
- monarchpoliticiandiplomat
- Biography
-
Tupou VI is the King of Tonga.
-
Greg James
- Occupations
- radio personalitywritertelevision presenter
- Biography
-
Gregory James Alan Milward is an English broadcaster and author. He has been a presenter on BBC Radio 1 since 2007, hosting shows including his old drive-time show and the station's flagship breakfast show.
-
Martin Tyler
- Occupations
- sports commentatorassociation football player
- Biography
-
Martin Tyler is an English football commentator. He worked as a commentator for Sky Sports from 1990 to 2023, covering the Premier League and UEFA Champions League, as well as other domestic and international competitions. Tyler had previously commentated for ITV in the 1970s and 1980s. He provided his voice to the football video game series FIFA from 2005 until 2019. In 2003, he was voted the FA Premier League Commentator of the Decade.
-
Gurinder Chadha
- Occupations
- screenwriterfilm directordirectorfilm producer
- Biography
-
Gurinder Kaur Chadha, OBE is a Kenyan-born British film director of Indian origin. Most of her films explore the lives of Indians living in England. The common theme in her work showcases the trials of Indian women residing in the UK and how they must reconcile their converging traditional and modern cultures. Many of her films address social and emotional issues, especially ones faced by immigrants caught between two worlds.
-
Simon Scarrow
- Occupations
- writeruniversity teacherhistorian
- Biography
-
Simon Scarrow is a British writer. Scarrow completed a master's degree at the University of East Anglia after working at the Inland Revenue, and then went into teaching as a lecturer, firstly at East Norfolk Sixth Form College, then at City College Norwich. Simon is a patron of the Bansang Hospital Appeal which supports an outstandingly innovative hospital in The Gambia.
-
Gareth Malone
- Occupations
- musicianconductortelevision presenterchoir director
- Biography
-
Gareth Edmund Malone OBE is an English choirmaster and broadcaster, self-described as an "animateur, presenter and populariser of choral singing". He is best known for his television appearances in programmes such as The Choir, which focus on singing and introducing choral music to new participants. Malone was appointed Officer of the Order of the British Empire (OBE) in the 2012 Birthday Honours, for services to music.
-
Charlie Higson
- Occupations
- writerscreenwritertelevision directoractorfilm producer
- Biography
-
Charles Murray Higson is an English actor, comedian, author and former singer. He has also written and produced for television and is the author of the young adult post-apocalyptic book series The Enemy, as well as the first five novels in the Young Bond series.
-
Tatiana de Rosnay
- Occupations
- screenwriterwriternovelistjournalist
- Biography
-
Tatiana de Rosnay is a French writer.
-
Vicki Pepperdine
- Occupations
- comedianactor
- Biography
-
Vicki Pepperdine is an English comedy actress and writer. She was nominated for two BAFTA TV Awards for co-writing the BBC sitcom Getting On (2009–12), and was also nominated for a British Comedy Award for her portrayal of Pippa Moore in the series.
-
Mathias Cormann
- Occupations
- politician
- Biography
-
Mathias Hubert Paul Cormann is a Belgian-born Australian politician and diplomat who currently serves as Secretary-General of the Organisation for Economic Co-operation and Development (OECD), having assumed the office on 1 June 2021.
-
Paul Nurse
- Enrolled in the University of East Anglia
- Graduated with Doctor of Philosophy
- Occupations
- researchergeneticistbiochemistchemist
- Biography
-
Sir Paul Maxime Nurse is an English geneticist, former President of the Royal Society and Chief Executive and Director of the Francis Crick Institute. He was awarded the 2001 Nobel Prize in Physiology or Medicine, along with Leland Hartwell and Tim Hunt, for their discoveries of protein molecules that control the division of cells in the cell cycle.
-
Caroline Flint
- Occupations
- politician
- Biography
-
Caroline Louise Flint is a British politician who served as Member of Parliament (MP) for Don Valley from 1997 to 2019. A member of the Labour Party, she attended the Cabinet as Minister for Housing and Planning in 2008 and Minister for Europe from 2008 to 2009.
-
Wayne Barnes
- Occupations
- barristerrugby union match official
- Biography
-
Wayne Barnes OBE is a retired English international rugby union referee. He was a frequent referee in the English Premiership, and refereed games in the Heineken Cup and the European Challenge Cup. At international level, Barnes refereed matches at the Rugby World Cup, the Six Nations, the Rugby Championship and the Pacific Nations Cup competitions.
-
Iain Dale
- Occupations
- politicianjournalistradio personalitywriterblogger
- Biography
-
Iain Dale is a British broadcaster, author, political commentator, and a former publisher and book retailer. He has been a blogger since 2002. He was the publisher of the Total Politics magazine between 2008 and 2012, and the managing director of Biteback Publishing until May 2018. Since September 2010, he has hosted a regular discussion show on the radio station LBC. He was named Radio Presenter of the Year at the Arqiva Commercial Radio Awards in 2013 and 2016. On 28 May 2024, he announced that he was quitting his LBC roles to run as an MP in the 2024 United Kingdom general election, only to abandon his campaign three days later. He returned to his usual LBC slot on 3 June.
-
Douglas Carswell
- Years
- 1971-.. (age 54)
- Occupations
- politicianresearcher
- Biography
-
John Douglas Wilson Carswell is a British former politician who served as a Member of Parliament from 2005 to 2017, co-founded Vote Leave, and since 2021 also serves as president and CEO of the Mississippi Center for Public Policy.
-
Tracy Chevalier
- Enrolled in the University of East Anglia
- In 1993 graduated with master's degree
- Occupations
- writernovelistscreenwriter
- Biography
-
Tracy Rose Chevalier is an American-British novelist. She is best known for her second novel, Girl with a Pearl Earring, which was adapted as a 2003 film starring Scarlett Johansson and Colin Firth.
-
Sarah Gilbert
- Enrolled in the University of East Anglia
- Graduated with bachelor's degree in biology
- Occupations
- professorimmunologistresearcher
- Biography
-
Dame Sarah Catherine Gilbert DBE FRS is an English vaccinologist who is a Professor of Vaccinology at the University of Oxford and co-founder of Vaccitech. She specialises in the development of vaccines against influenza and emerging viral pathogens. She led the development and testing of the universal flu vaccine, which underwent clinical trials in 2011.
-
James Vowles
- Occupations
- engineerteam manager
- Biography
-
James Patrick Vowles is a British motorsport engineer and Team Principal of Williams Racing. Before joining Williams, he was the motorsport strategy director at Mercedes-AMG Petronas Formula One Team. He was also responsible for the Brawn GP race strategy, which was critical to the team's championship-winning 2009 season. He has worked in Formula One for over 20 years, including under the leadership of team principals David Richards, Ross Brawn, and Toto Wolff, and has played a key role in nine Constructors' Championships, eight Drivers' Championships and over 100 Grands Prix wins.
-
Philip Mould
- Occupations
- art critictelevision presenterart dealer
- Biography
-
Philip Jonathan Clifford Mould OBE is an English art dealer, London gallery owner, art historian, writer and broadcaster. He has made a number of major art discoveries, including works of Thomas Gainsborough, Anthony Van Dyck and Thomas Lawrence.
-
Eduardo Costantini
- Occupations
- businesspersoneconomistphilanthropist
- Biography
-
Eduardo Francisco Costantini is an Argentine real estate developer and businessman and the founder and chairman of the Museum of Latin American Art of Buenos Aires (MALBA). As of September 2024, Forbes estimated his net worth at US$1.6 billion.
-
Bendor Grosvenor
- Occupations
- television presenterart historianart dealer
- Biography
-
Bendor Gerard Robert Grosvenor is a British art historian, writer and former art dealer. He is known for discovering a number of important lost artworks by Old Master artists, including Sir Peter Paul Rubens, Claude Lorrain and Peter Brueghel the Younger. As a dealer he specialised in Old Masters, with a particular interest in Anthony van Dyck.
-
Tito Mboweni
- Occupations
- politicianeconomist
- Biography
-
Tito Titus Mboweni was a South African politician who served as Minister of Finance of South Africa in the government of President Cyril Ramaphosa from 2018 to 2021.
-
Valerie Amos, Baroness Amos
- Occupations
- sociologistpoliticiandiplomat
- Biography
-
Valerie Ann Amos, Baroness Amos is a British Labour Party politician and diplomat who served as the eighth UN Under-Secretary-General for Humanitarian Affairs and Emergency Relief Coordinator. Before her appointment to the UN, she served as British High Commissioner to Australia. She was created a life peer in 1997, serving as Leader of the House of Lords and Lord President of the Council from 2003 to 2007.
-
Joanna Coles
- Occupations
- editorfilm producer
- Biography
-
Joanna Louise Coles was chief content officer for Hearst Magazines from 2016 to 2018.
-
Murat Karayalçın
- Occupations
- diplomatpolitician
- Biography
-
Murat Karayalçın is a prominent Turkish politician. He is a former foreign minister (1994–1995), deputy prime minister, and a former mayor of Ankara (1989–1993). He is the founder (in 2002) of the new SHP.
-
Steve Oram
- Occupations
- film directoractorcomediantelevision actorscreenwriter
- Biography
-
Stephen John Oram is an English actor, comedian, writer, and filmmaker. He is known for his role in the multi-award winning 2012 film Sightseers, which he also co-wrote. His other credits include People Like Us (2001), It's All Gone Pete Tong (2004), Tittybangbang (2006–2007), Suburban Shootout (2006), The Mighty Boosh (2007), Connections (2008), The World's End (2013), Wipers Times (2013), The Secrets (2014), The Canal (2014), Altar (2014), Paddington (2014), Glue (2014), Aaaaaaaah! (2015), The Living and the Dead (2016), A Dark Song (2016), The End of the F***ing World (2017–2019), Ghosts (2019), Doctor Who (2021), Killing Eve (2022), and D.I Ray (2022–2023).
-
Arthur Smith
- Occupations
- improviseractorcomediantelevision actorwriter
- Biography
-
Brian Arthur John Smith is an English alternative comedian, presenter and writer.
-
Anne Enright
- Occupations
- essayistwritertelevision directornovelistfilm director
- Biography
-
Anne Teresa Enright FRSL is an Irish writer. The first Laureate for Irish Fiction (2015–2018) and winner of the Man Booker Prize (2007), she has published eight novels, many short stories, and a non-fiction work called Making Babies: Stumbling into Motherhood, about the birth of her two children. Her essays on literary themes have appeared in the London Review of Books and The New York Review of Books, and she writes for the books pages of The Irish Times and The Guardian. Her fiction explores themes such as family, love, identity and motherhood.
-
Jeff Minter
- Occupations
- television producercomputer scientistengineerprogrammer
- Biography
-
Jeff Minter is an English video game designer and programmer who often goes by the name Yak. He is the founder of software house Llamasoft and has created dozens of games during his career, which began in 1981 with games for the ZX80. Minter's games are shoot 'em ups which contain titular or in-game references demonstrating his fondness of ruminants (llamas, sheep, camels, etc.). Many of his programs also feature something of a psychedelic element, as in some of the earliest "light synthesizer" programs including Trip-a-Tron.
-
Steve Lightfoot
- Occupations
- screenwritertelevision producer
- Biography
-
Steve Lightfoot is a British television writer and producer who worked as an executive producer and writer on the NBC thriller television series Hannibal, the Netflix series The Punisher and, recently, the Netflix thriller miniseries Behind Her Eyes and Shantaram.
-
David Almond
- Occupations
- children's writerauthoryoung adult authornovelistwriter
- Biography
-
David Almond is a British author who has written many novels for children and young adults from 1998, each one receiving critical acclaim.
-
Princess Anna, Princess Manuel of Bavaria
- Enrolled in the University of East Anglia
- Graduated with Master of Arts in creative writing
- Occupations
- journalistwriter
- Biography
-
Princess Anna of Bavaria, known professionally as Anna von Bayern, is a German journalist and author who has been serving as the Chief Corporate Affairs Officer at Coty Inc. since 2020. A member of the House of Sayn-Wittgenstein-Berleburg by birth, she became a member of the House of Wittelsbach in 2005 through her marriage to Prince Manuel of Bavaria.
-
Binyavanga Wainaina
- Occupations
- journalistwriter
- Biography
-
Kenneth Binyavanga Wainaina was a Kenyan author, journalist and 2002 winner of the Caine Prize for African Writing. In 2003, he was the founding editor of Kwani? literary magazine. In April 2014, Time magazine included Wainaina in its annual Time 100 as one of the "Most Influential People in the World".
-
Andrew Bolton
- Occupations
- curator
- Biography
-
Andrew John Bolton OBE is a British museum curator and current head curator of the Anna Wintour Costume Center at the Metropolitan Museum of Art in New York City, the host venue for the annual Met Gala.
-
Adrian Ramsay
- Occupations
- politician
- Biography
-
Adrian Philip Ramsay is a British politician who has served as co-leader of the Green Party of England and Wales since 2021 and as the Member of Parliament for Waveney Valley since 2024. He was previously the deputy leader of the Green Party of England and Wales from 2008 to 2012. He served as a Norwich City Councillor from 2003 to 2011. He worked as chief executive of the Centre for Alternative Technology from 2014 to 2019 and from 2019 to 2024 was CEO of MCS Charitable Foundation.
-
Rachael Maskell
- Occupations
- politician
- Biography
-
Rachael Helen Maskell is a British Labour and Co-operative politician who has served as Member of Parliament (MP) for York Central since 2015. She was Shadow Environment Secretary from 2016 to 2017 and Shadow Employment Secretary in 2020.
-
Thomas Galbraith, 2nd Baron Strathclyde
- Occupations
- businesspersonpolitician
- Biography
-
Thomas Galloway Dunlop du Roy de Blicquy Galbraith, 2nd Baron Strathclyde, CH, PC, known informally as Tom Strathclyde, is a British Conservative politician. Lord Strathclyde served in the political role of Leader of the House of Lords from the 2010 general election until January 2013 and as Chancellor of the Duchy of Lancaster, having been Leader of the Opposition in the House of Lords (1998–2010). As of 2025, he is the most recent hereditary peer to serve as Leader of the Lords.
-
Jasmine Blackborow
- Occupations
- filmmakervoice actoraudiobook narratoractor
- Biography
-
Jasmine Sky Blackborow is an English actress who began her career in theatre. On television, she is known for her roles in the first season of the Netflix series Shadow and Bone (2021), the Canal+ and BBC drama Marie Antoinette (2022), and Guy Richie's The Gentlemen (2024), also on Netflix. Her films include Daemon Mind (2022).
-
Mohammed Hanif
- Occupations
- journalistwriter
- Biography
-
Mohammed Hanif is a British-Pakistani writer and journalist. His work has been published by The New York Times, The Daily Telegraph, The New Yorker and The Washington Post. Hanif worked as a correspondent for the BBC News based in Karachi and was the writer of a feature film about the city, The Long Night. Hanif has written two novels, A Case of Exploding Mangoes. and Our Lady of Alice Bhatti, as well as a play, The Dictator's Wife, which was staged at the Hampstead Theatre.
-
Louise Doughty
- Occupations
- writertheatre criticlecturerplaywrightnovelist
- Biography
-
Louise Doughty is an English novelist and screenwriter. She is best known for her bestselling novels, including Apple Tree Yard. She has also worked as a cultural critic for newspapers and magazines. Her weekly column for The Daily Telegraph was published as A Novel in a Year in 2007. Doughty was the presenter of the BBC Radio 4 programme A Good Read in 1998 to 2001.
-
Raoul Schrott
- Occupations
- writertranslatorpoetliterary critic
- Biography
-
Raoul Schrott is an Austrian poet, writer, literary critic, translator and broadcast personality.
-
Jim Chapman
- Occupations
- television producermodelwriterYouTuberblogger
- Biography
-
Jim Chapman is an English YouTuber. Chapman began posting videos on his YouTube channel in 2010 and released his first book, titled 147 Things, on 5 October 2017.
-
David Anthony King
- Occupations
- chemist
- Biography
-
Sir David Anthony King is a South African-born British chemist, academic, and head of the Climate Crisis Advisory Group (CCAG).
-
Zeb Soanes
- Occupations
- journalisttelevision presenternews presenter
- Biography
-
Zebedee Soanes is a British radio presenter who hosts the weekday evening music show Relaxing Evenings with Zeb Soanes on Classic FM.
-
Michael Hüther
- Occupations
- university teachereconomist
- Biography
-
Michael Hüther is a German economist who currently serves as director of the Institut der deutschen Wirtschaft. He has previously been the chief economist of DekaBank. Hüther also is an honorary professor at the European Business School International University Schloss Reichartshausen.
-
Gino Costa
- Occupations
- lawyerpolitician
- Biography
-
Gino Francisco Costa Santolalla is a Peruvian politician who is an Independent Congressman caucusing with the Purple Party, representing the constituency of Lima.
-
Paul Stewart
- Occupations
- writerchildren's writernovelistteacher
- Biography
-
Paul Stewart is a writer of children's books, best known for three series written in collaboration with the illustrator Chris Riddell: The Edge Chronicles, the Free Lance novels, and the Far Flung Adventures series.
-
Stephen Lambert
- Occupations
- television producer
- Biography
-
Stephen Lambert is an English television producer and executive who works in Britain and America. He is the chief executive of Studio Lambert, one of All3Media's production companies, which produces Gogglebox, Undercover Boss, Squid Game: The Challenge, Race Across the World, The Circle and The Traitors.
-
Owen Sheers
- Occupations
- writerplaywrightpoetnovelist
- Biography
-
Owen Sheers FRSL is a Welsh poet, author, playwright and television presenter. He was the first writer-in-residence to be appointed by any national rugby union team.
-
Michael Houghton
- Occupations
- researcherbiochemistvirologistmicrobiologist
- Biography
-
Sir Michael Houghton is a British scientist and Nobel Prize laureate. Along with Qui-Lim Choo, George Kuo and Daniel W. Bradley, he co-discovered Hepatitis C in 1989. He also co-discovered the Hepatitis D genome in 1986. The discovery of the Hepatitis C virus (HCV) led to the rapid development of diagnostic reagents to detect HCV in blood supplies, which has reduced the risk of acquiring HCV through blood transfusion from one in three to about one in two million. It is estimated that antibody testing has prevented at least 40,000 new infections per year in the US alone and many more worldwide.
-
Andrew Miller
- Occupations
- writernovelist
- Biography
-
Andrew Brooke Miller FRSL is an English novelist.
-
Gary Cheng
- Enrolled in the University of East Anglia
- 1986-1987 studied education
- Occupations
- politician
- Biography
-
Gary Cheng Kai Nam is a Hong Kong politician who served as vice-chairman for the Democratic Alliance for the Betterment and Progress of Hong Kong party. He was educated at Pui Kiu Middle School, the University of East Anglia (BA), and the University of Hong Kong. He was a longtime member of the Legislative Council. During the legislative election in 2000, he was exposed for failing to disclose his personal own assets and became a suspect for corruption. In the end, he gave up his seat in the Legislative Council. In 2001, the court found Cheng guilty of abuse of power and sentenced him to 18 months in jail.
-
Robert Fulton
- Years
- 1948-.. (age 77)
- Occupations
- military officer
- Biography
-
Lieutenant General Sir Robert Henry Gervase Fulton, KBE, KStJ is a retired British Royal Marines officer who served as Governor of Gibraltar from 2006 to 2009.
-
Donald Kaberuka
- Occupations
- economist
- Biography
-
Donald P. Kaberuka is a Rwandan economist and was the president of the African Development Bank from September 2005 until September 2015.
-
Margaret Stohl
- Occupations
- writernovelist
- Biography
-
Margaret Stohl is an American novelist. She is the author of 14 novels, as well as 5 volumes of comics and several video games. She lives in Santa Monica, California.
-
Doc Brown
- Occupations
- screenwritermusiciancomedian
- Biography
-
Benjamin Harvey Bailey Smith, professionally known as Doc Brown, is an English actor, comedian, rapper, screenwriter, songwriter, producer and voiceover artist. He portrayed DS Joe Hawkins in the television series Law & Order: UK. He is also known for portraying Nathan Carter in the CBBC television series 4 O'Clock Club from 2012 to 2015, and Imperial Security Bureau agent Lieutenant Supervisor Blevin in Andor.
-
Neel Mukherjee
- Occupations
- writernovelist
- Biography
-
Neel Mukherjee, FRSL is an Indian English-language writer based in London. He is the author of several critically acclaimed novels. He is also the brother of the television anchor and editor Udayan Mukherjee.
-
Robin Devereux, 19th Viscount Hereford
- Years
- 1975-.. (age 50)
- Occupations
- businessperson
- Biography
-
Charles Robin de Bohun Devereux, 19th Viscount Hereford, 16th Baronet, is the premier viscount in the Peerage of England.
-
Karin Smyth
- Occupations
- politician
- Biography
-
Karin Marguerite Smyth is a British Labour Party politician serving as Member of Parliament (MP) for Bristol South since 2015. She has served as a Minister of State for Secondary Care since July 2024.
-
Ayobami Adebayo
- Occupations
- writernovelist
- Biography
-
Ayọ̀bámi Adébáyọ̀ is a Nigerian writer. Her 2017 debut novel, Stay With Me, won the 9mobile Prize for Literature and the Prix Les Afriques. She was awarded The Future Awards Africa Prize for Arts and Culture in 2017.
-
Sasha Saidin
- Occupations
- actorsinger
- Biography
-
Sasha Mohd Saidin is a Malaysian singer and actress. She was formerly a member of the Malaysian pop group "Elite".
-
Helon Habila
- Occupations
- writeruniversity teacherpoet
- Biography
-
Helon Habila Ngalabak is a Nigerian novelist and poet, whose writing has won many prizes, including the Caine Prize in 2001. He worked as a lecturer and journalist in Nigeria before moving in 2002 to England, where he was a Chevening Scholar at the University of East Anglia, and now teaches creative writing at George Mason University, Fairfax, Virginia.
-
Paul Atterbury
- Years
- 1945-.. (age 80)
- Occupations
- antiquarian sellerart historiancuratortelevision presenterpuppeteer
- Biography
-
Paul Rowley Atterbury, FRSA is a British antiques expert, known for his many appearances since 1979 on the BBC TV programme Antiques Roadshow. He specialises in the art, architecture, design and decorative arts of the 19th and 20th centuries.
-
Steve Blame
- Occupations
- journalisttelevision presenter
- Biography
-
Steve Blame is a British television presenter and screenwriter. He was the news editor and presenter between 1987 and 1994 for the television channel MTV.
-
Adam Tomkins
- Enrolled in the University of East Anglia
- Graduated with Bachelor of Laws
- Occupations
- politician
- Biography
-
Adam Tomkins is a British academic and politician who is the John Millar Professor of Public Law at the University of Glasgow School of Law. A member of the Scottish Conservatives, he was a Member of the Scottish Parliament (MSP) for the Glasgow region from 2016 to 2021, when he stood down for that year's elections.
-
Sandra Newman
- Occupations
- novelist
- Biography
-
Sandra Newman is an American writer. She has a BA from Polytechnic of Central London, and an MA from the University of East Anglia.
-
Natasha Pulley
- Occupations
- writernovelistteacher
- Biography
-
Natasha Katherine Pulley is a British author. She is best known for her debut novel, The Watchmaker of Filigree Street, which won a Betty Trask Award.
-
Terry Edwards
- Occupations
- saxophonist
- Biography
-
Terry Edwards is an English musician who plays trumpet, flugelhorn, saxophones, guitar and keyboards.
-
Peter Fahy
- Occupations
- police officer
- Biography
-
Sir Peter Martin Fahy QPM is a retired senior British police officer. He was the Chief Constable of Greater Manchester Police (GMP), the United Kingdom's third largest police force. He retired from the police force on 23 October 2015 after serving for 34 years.
-
Emma Healey
- Occupations
- bookbinderwriter
- Biography
-
Emma Constance Healey is a British novelist. Her debut novel, Elizabeth Is Missing won the annual Costa Book Award for First Novel.
-
Tom Moran
- Years
- 1987-.. (age 38)
- Occupations
- screenwriternovelistcomedian
- Biography
-
Tom Moran is a British screenwriter.
-
Suchart Thadathamrongvej
- Occupations
- politicianeconomist
- Biography
-
Suchart Thada-Thamrongvech is a Thai politician and professor. He served as Minister of Finance under Samak Sundaravej and Somchai Wongsawat from August to December 2008 and as Minister of Education in the Cabinet of Yingluck Shinawatra from January to October 2012. From September to November 2008, he was the chairman of the Pheu Thai Party.
-
John Ashdown-Hill
- Occupations
- teacherhistorian
- Biography
-
Louis John Frederick Ashdown-Hill MBE FSA, commonly known as John Ashdown-Hill, was an independent historian and author of books on late medieval English history with a focus on the House of York and Richard III. Ashdown-Hill died on 18 May 2018; he had had motor neurone disease for some time.
-
Manuel de Araújo
- Occupations
- politicianeconomist
- Biography
-
Manuel A. Alculete Lopes de Araújo is a Mozambican politician who has been Mayor of Quelimane since December 2011.
-
Diana Evans
- Occupations
- journalistnovelist
- Biography
-
Diana Omo Evans FRSL is a British novelist, journalist and critic who was born and lives in London. Evans has written four full-length novels. Her first novel, 26a, published in 2005, won the Orange Award for New Writers, the Betty Trask Award and the deciBel Writer of the Year award. Her third novel Ordinary People was shortlisted for the 2019 Women's Prize for Fiction and won the 2019 South Bank Sky Arts Award for Literature. A House for Alice was published in 2023.
-
Carlyle Glean
- Occupations
- politician
- Biography
-
Sir Carlyle Arnold Glean, GCMG was a Grenadian politician, who served as governor-general of Grenada from 2008 to 2013.
-
Tolu Ogunlesi
- Occupations
- photographerwriterpoetjournalist
- Biography
-
Tolu Ogunlesi is a Nigerian journalist, poet, photographer, fiction writer, and blogger. Ogunlesi was appointed to the role of special assistant on digital/new media by President Muhammadu Buhari on 18 February 2016.
-
Árni Þórarinsson
- Occupations
- journalistwriter
- Biography
-
Árni Þórarinsson is an Icelandic writer born in Reykjavík on 1 August 1950. He received his B.A. in 1973 from the University of East Anglia in Norwich, England.
-
Murad Qureshi
- Occupations
- journalist
- Biography
-
Murad Qureshi is a British Labour and Co-operative Party politician, and a former Member of the London Assembly.
-
Richard Beard
- Occupations
- writernovelistsports journalistteacher
- Biography
-
Richard James Beard is an English author of fiction and non-fiction books and short literature. He is the winner of the 2018 Ackerley Prize for his memoir The Day That Went Missing.
-
Benjamin D. Santer
- Occupations
- climatologistresearcher
- Biography
-
Benjamin David Santer was a climate researcher at Lawrence Livermore National Laboratory and former researcher at the University of East Anglia's Climatic Research Unit. He retired from the Lawrence Livermore National Laboratory in 2021 and is now a Distinguished Scholar in Residence at Woods Hole Oceanographic Institution. He also worked at the Max Planck Institute for Meteorology from 1987 to 1992. He specializes mainly in statistical analysis of climate data sets, and detection/attribution of climate change forcings.
-
Michael Heaver
- Occupations
- politician
- Biography
-
Michael Eric Heaver is a British broadcaster and former politician. He was elected as a Brexit Party Member of the European Parliament (MEP) for the East of England constituency in the 2019 election and served in that role until the United Kingdom's withdrawal from the EU. Previously, he was the chair of the UK Independence Party (UKIP)'s youth wing, Young Independence.
-
Glenn Patterson
- Years
- 1961-.. (age 64)
- Occupations
- writer
- Biography
-
Glenn Patterson FRSL is a writer from Belfast, Northern Ireland, best known as a novelist. In 2023, he was elected a Fellow of the Royal Society of Literature.
-
Erica Wagner
- Occupations
- writerjournalistliterary critic
- Biography
-
Erica Wagner FRSL is an American author and critic, living in London, England. She is former literary editor of The Times.
-
Tamara Ingram
- Occupations
- businessperson
- Biography
-
Tamara Ingram, OBE is a British businesswoman. Tamara is currently chairman of integrated content agency The 10 Group, Asthma and Lung UK, Chair of the ESG committee as a NED for Marks and Spencer and non executive director of Intertek and Marsh Mclennan.
-
Luke Wright
- Years
- 1982-.. (age 43)
- Occupations
- poet
- Biography
-
Luke Wright is a British poet, performer, publisher, curator and broadcaster.
-
Rosalind Scott, Baroness Scott of Needham Market
- Occupations
- politician
- Biography
-
Rosalind Carol "Ros" Scott, Baroness Scott of Needham Market is a British Liberal Democrat politician, non-executive director of the National Archives and a member of the House of Lords. Baroness Scott was president of the Liberal Democrats between 1 January 2009 and 31 December 2010 and was succeeded by Tim Farron.
-
Alexander Gordon Smith
- Occupations
- writerchildren's writerpublisher
- Biography
-
Alexander Gordon Smith is an author of children and Young Adult fiction.
-
Mark Cocker
- Years
- 1959-.. (age 66)
- Occupations
- naturalist
- Biography
-
Mark Cocker is a British author and naturalist. He lives with his wife, Mary Muir, and two daughters in Claxton, Norfolk. The countryside around Claxton is a theme for two of his twelve books.
-
Adam Foulds
- Occupations
- writernovelistpoet
- Biography
-
Adam Samuel James Foulds FRSL is a British novelist and poet.
-
Zoya Phan
- Occupations
- human rights activist
- Biography
-
Zoya Phan is a Burmese political activist. She resides in the United Kingdom, and is the Campaign Manager of the human rights organization Burma Campaign UK. She was an outspoken critic of the Burmese government when it was under direct military rule, repeatedly calling for democratic reform in Burma, as well as economic sanctions from both the British government and the United Nations. Following political changes in the country from 2011, she has continued to campaign for international action to end ongoing human rights violations, especially regarding the use of rape and sexual violence against ethnic women by the Burmese Army.
-
Mark Coeckelbergh
- Occupations
- philosopher
- Biography
-
Mark Coeckelbergh is a Belgian philosopher of technology. He is Professor of Philosophy of Media and Technology at the Department of Philosophy of the University of Vienna and former President of the Society for Philosophy and Technology. He was previously Professor of Technology and Social Responsibility at De Montfort University in Leicester, UK, Managing Director of the 3TU Centre for Ethics and Technology, and a member of the Philosophy Department of the University of Twente. Before moving to Austria, he has lived and worked in Belgium, the UK, and the Netherlands. He is the author of several books, including Growing Moral Relations (2012), Human Being @ Risk (2013), Environmental Skill (2015), Money Machines (2015), New Romantic Cyborgs (2017), Moved by Machines (2019), the textbook Introduction to Philosophy of Technology (2019), and AI Ethics (2020). He has written many articles and is an expert in ethics of artificial intelligence. He is best known for his work in philosophy of technology and ethics of robotics and artificial intelligence (AI), he has also published in the areas of moral philosophy and environmental philosophy.
