100 Notable alumni of
University of Sussex

Updated:

EduRank

The University of Sussex is 238th in the world, 81st in Europe, and 17th in the United Kingdom by aggregated alumni prominence. Below is the list of 100 notable alumni from the University of Sussex sorted by their wiki pages popularity. The directory includes famous graduates and former students along with research and academic staff. 2 individuals affiliated with the University of Sussex won Nobel Prizes in Chemistry.

  1. Billy Idol

    Billy Idol
    Born in
    United Kingdom Flag United Kingdom
    Years
    1955-.. (age 70)
    Occupations
    actorfilm actorsingerguitaristsongwriter
    Biography

    William Michael Albert Broad, known professionally as Billy Idol, is an English punk singer, songwriter, musician and actor. He achieved fame in the 1970s emerging from the London punk rock scene as the lead singer of the group Generation X. Subsequently, he embarked on a solo career which led to international recognition and made Idol a lead artist during the MTV-driven "Second British Invasion" in the US.

  2. Walter O'Brien

    Walter O'Brien
    Born in
    Ireland Flag Ireland
    Years
    1975-.. (age 50)
    Occupations
    television producercomputer securitywhite hatchief executive officer
    Biography

    Walter O'Brien is an Irish businessman and information technologist. He was also the executive producer and loose inspiration for the television series Scorpion. He is known for claiming various accomplishments, including a childhood IQ of 197, which have been scrutinized and remain unproven.

  3. Burna Boy

    Burna Boy
    Born in
    Nigeria Flag Nigeria
    Years
    1991-.. (age 34)
    Enrolled in the University of Sussex
    Studied in 2008-2009
    Occupations
    record producermusiciansongwritersinger
    Biography

    Damini Ebunoluwa Ogulu MFR, known professionally as Burna Boy, is a Nigerian singer, songwriter, performer and record producer. He gained recognition in 2012 after releasing "Like to Party", the lead single from his debut studio album L.I.F.E (2013). In 2017, Burna Boy signed a record deal with Atlantic Records and its parent company Warner Music Group. His third studio album Outside, which also serves as his major label debut, was released in 2018.

  4. Jim Carter

    Jim Carter
    Born in
    United Kingdom Flag United Kingdom
    Years
    1948-.. (age 77)
    Occupations
    film actoractorlighting designerstage actortelevision actor
    Biography

    James Edward Carter is an English actor. He is best known for his role as Mr Carson in the ITV historical drama series Downton Abbey (2010–2015), which earned him four nominations for the Primetime Emmy Award for Outstanding Supporting Actor in a Drama Series (2012–2015). He reprised the role in the feature films Downton Abbey (2019) and Downton Abbey: A New Era (2022).

  5. Ian McEwan

    Ian McEwan
    Born in
    United Kingdom Flag United Kingdom
    Years
    1948-.. (age 77)
    Enrolled in the University of Sussex
    In 1970 graduated with Bachelor of Arts
    Occupations
    screenwriterwriterplaywrightfilm screenwriternovelist
    Biography

    Ian Russell McEwan CH CBE FRSA FRSL is a British novelist and screenwriter. In 2008, The Times featured him on its list of "The 50 greatest British writers since 1945" and The Daily Telegraph ranked him number 19 in its list of the "100 most powerful people in British culture".

  6. Kemi Badenoch

    Kemi Badenoch
    Born in
    United Kingdom Flag United Kingdom
    Years
    1980-.. (age 45)
    Enrolled in the University of Sussex
    Graduated with Master of Engineering
    Occupations
    authorpolitician
    Biography

    Olukemi Olufunto Adegoke Badenoch is a British politician who has served as Leader of the Opposition and Leader of the Conservative Party since November 2024. The first Black person to hold those offices, Badenoch previously served in the Cabinet under Liz Truss and Rishi Sunak from 2022 to 2024. She has been Member of Parliament (MP) for North West Essex, previously Saffron Walden, since 2017.

  7. Sara Pascoe

    Sara Pascoe
    Born in
    United Kingdom Flag United Kingdom
    Years
    1981-.. (age 44)
    Occupations
    opinion journaliststand-up comedianactorcomedianscreenwriter
    Biography

    Sara Patricia Pascoe is an English actress, comedian, presenter and writer. She has appeared on television programmes including 8 Out of 10 Cats Does Countdown and Taskmaster for Channel 4 and QI for BBC Two.

  8. Thabo Mbeki

    Thabo Mbeki
    Born in
    South Africa Flag South Africa
    Years
    1942-.. (age 83)
    Enrolled in the University of Sussex
    In 1962 graduated with Bachelor of Arts in economics
    Occupations
    politicianeconomist
    Biography

    Thabo Mvuyelwa Mbeki is a South African politician who served as the 2nd democratic president of South Africa from 14 June 1999 to 24 September 2008, when he resigned at the request of his party, the African National Congress (ANC). Before that, he was deputy president under Nelson Mandela from 1994 to 1999.

  9. Bob Mortimer

    Bob Mortimer
    Born in
    United Kingdom Flag United Kingdom
    Years
    1959-.. (age 66)
    Occupations
    actorscreenwritertelevision presenterwritercomedian
    Biography

    Robert Renwick Mortimer is an English comedian, author, television presenter, writer and actor. He is best known for his work with Vic Reeves as the comedy double act Reeves and Mortimer, and more recently the Mortimer & Whitehouse: Gone Fishing series with Paul Whitehouse. He has appeared on TV panel shows such as Would I Lie to You? and Taskmaster.

  10. Noel Tata

    Noel Tata
    Years
    1956-.. (age 69)
    Occupations
    businessperson
    Biography

    Noel Naval Tata is an Indian-born Irish businessman. He is the chairman of the Tata Trusts, Trent and Tata Investment Corporation, the managing director of Tata International, and the vice chairman of Titan Company and Tata Steel.

  11. Jessie Ware

    Jessie Ware
    Born in
    United Kingdom Flag United Kingdom
    Years
    1984-.. (age 41)
    Occupations
    composersinger-songwriterrecording artistsinger
    Biography

    Jessica Lois Ware is an English singer and songwriter. She came to prominence following the release of her debut studio album, Devotion (2012), which peaked at number five on the UK Albums Chart and produced the single "Wildest Moments". Her second studio album, Tough Love (2014), reached number nine in the UK and produced the singles "Tough Love" and "Say You Love Me". Her third studio album, Glasshouse (2017), reached number seven in the UK.

  12. Lucy Worsley

    Lucy Worsley
    Born in
    United Kingdom Flag United Kingdom
    Years
    1973-.. (age 52)
    Enrolled in the University of Sussex
    1997-2001 graduated with Doctor of Philosophy
    Occupations
    writertelevision presenterhistorian
    Biography

    Lucy Worsley OBE is an English historian, author, curator and television presenter. She was the joint chief curator at Historic Royal Palaces but is best known as a presenter of BBC Television and Channel 5 series on historical topics.

  13. Frankie Boyle

    Frankie Boyle
    Born in
    United Kingdom Flag United Kingdom
    Years
    1972-.. (age 53)
    Occupations
    screenwriterwritertelevision presenterautobiographercomedian
    Biography

    Francis Martin Patrick Boyle is a Scottish comedian and writer. Boyle first gained widespread recognition as a regular panellist on the comedy show Mock the Week from 2005 until 2009. He then created and starred in the Channel 4 sketch show Frankie Boyle's Tramadol Nights (2010) and BBC Two's chat show Frankie Boyle's New World Order (2017–2022). In 2020, he presented a four-part series on BBC Two, Frankie Boyle's Tour of Scotland. He has embarked on a number of tours, releasing several stand-up specials. Boyle has been involved in several public controversies due to his humour.

  14. Philippa Gregory

    Philippa Gregory
    Born in
    Kenya Flag Kenya
    Years
    1954-.. (age 71)
    Occupations
    writernovelist
    Biography

    Philippa Gregory CBE is an English historical novelist who has been publishing since 1987. The best known of her works is The Other Boleyn Girl (2001), which in 2002 won the Romantic Novel of the Year Award from the Romantic Novelists' Association and has been adapted into two films.

  15. Bertie Carvel

    Bertie Carvel
    Born in
    United Kingdom Flag United Kingdom
    Years
    1977-.. (age 48)
    Occupations
    actorfilm actorstage actortelevision actorvoice actor
    Biography

    Robert Hugh Carvel is a British film and theatre actor. He has twice won a Laurence Olivier Award: for Best Actor in a Leading Role in a Musical for his role as Miss Trunchbull in Matilda the Musical, and for Best Actor in a Supporting Role for his performance as Rupert Murdoch in Ink. For the latter role, he won the Tony Award for Best Actor in a Featured Role in a Play.

  16. Tony Banks

    Tony Banks
    Born in
    United Kingdom Flag United Kingdom
    Years
    1950-.. (age 75)
    Occupations
    composerkeyboardistguitaristsongwriterpianist
    Biography

    Anthony George Banks is an English musician primarily known as the keyboardist and founding member of the rock band Genesis. Banks is also a prolific solo artist, releasing six solo studio albums that range through progressive rock, pop, and classical music.

  17. Steve Toussaint

    Steve Toussaint
    Born in
    United Kingdom Flag United Kingdom
    Years
    1965-.. (age 60)
    Occupations
    film actoractortelevision actor
    Biography

    Stephen Toussaint is a British actor and writer. He first gained prominence through his role in the ITV crime drama The Knock (1994–2000). Currently, he plays Lord Corlys Velaryon in the HBO fantasy series House of the Dragon.

  18. Cariad Lloyd

    Cariad Lloyd
    Born in
    United Kingdom Flag United Kingdom
    Years
    1982-.. (age 43)
    Occupations
    improviseractorcomedian
    Biography

    Katie Cariad Lloyd is a British comedian, actress, writer, and podcaster. She is a member of the improvisational comedy group Austentatious, the host and creator of Griefcast, and an improv teacher.

  19. Clive Myrie

    Clive Myrie
    Born in
    United Kingdom Flag United Kingdom
    Years
    1964-.. (age 61)
    Occupations
    journalisttelevision presenter
    Biography

    Clive Augustus Myrie is a British journalist, newsreader and presenter who works for the BBC. He is one of the BBC's chief news presenters and correspondents, as well as their election results presenter. Since August 2021 he has been the host of the long-running BBC quiz shows Mastermind and Celebrity Mastermind.

  20. Virginia Wade

    Virginia Wade
    Born in
    United Kingdom Flag United Kingdom
    Years
    1945-.. (age 80)
    Enrolled in the University of Sussex
    Graduated with Bachelor of Science in mathematics
    Occupations
    tennis player
    Biography

    Sarah Virginia Wade OBE is a British former professional tennis player. She won three major tennis singles championships and four major doubles championships, and is the only British woman in history to have won titles at all four majors. She was ranked as high as No. 2 in the world in singles, and No. 1 in the world in doubles.

  21. Michael Fabricant

    Michael Fabricant
    Born in
    United Kingdom Flag United Kingdom
    Years
    1950-.. (age 75)
    Occupations
    politician
    Biography

    Sir Michael Louis David Fabricant is a British politician. A member of the Conservative Party, he served as the Member of Parliament (MP) for Lichfield in Staffordshire, formerly Mid Staffordshire, from 1992 until his defeat in 2024.

  22. Hilary Benn

    Hilary Benn
    Born in
    United Kingdom Flag United Kingdom
    Years
    1953-.. (age 72)
    Occupations
    politician
    Biography

    Hilary James Wedgwood Benn is a British politician who has served as Secretary of State for Northern Ireland since 2024. A member of the Labour Party, he has been the Member of Parliament (MP) for Leeds South, formerly Leeds Central, since 1999. He previously served in various ministerial positions under Prime Ministers Tony Blair and Gordon Brown from 2001 to 2010.

  23. Mura Masa

    Mura Masa
    Years
    1996-.. (age 29)
    Occupations
    record producerdisc jockeycomposerrecording artist
    Biography

    Alexander George Edward Crossan, better known by his stage name Mura Masa, is a Guernsey-born electronic record producer and songwriter. Crossan is best known for his 2016 song "Lovesick" (featuring ASAP Rocky), which peaked at number 59 on the UK singles chart. He produced English singer PinkPantheress' 2022 single "Boy's a Liar", which peaked at number two on the chart, while its remix with American rapper Ice Spice peaked at number three on the US Billboard Hot 100.

  24. Nigel Planer

    Nigel Planer
    Born in
    United Kingdom Flag United Kingdom
    Years
    1953-.. (age 72)
    Occupations
    screenwriternovelistsingerdub actorcomedian
    Biography

    Nigel George Planer is a British actor, writer and musician. He played Neil in the BBC comedy The Young Ones and Ralph Filthy in Filthy Rich & Catflap. He has appeared in many West End musicals, including original casts of Evita, Chicago, We Will Rock You, Wicked, and Charlie and the Chocolate Factory. He has also appeared in Hairspray. He won a BRIT award in 1984 and has been nominated for Olivier, TMA, WhatsOnStage, and BAFTA awards.

  25. Bruno Heller

    Bruno Heller
    Born in
    United Kingdom Flag United Kingdom
    Years
    1960-.. (age 65)
    Occupations
    directorscreenwriterfilm producerexecutive producerfilm director
    Biography

    Bruno Heller is a British screenwriter, producer and director. He is known for creating the HBO television series Rome, the CBS television series The Mentalist, and the FOX television series Gotham, based on the Batman franchise, co-creating the Gotham prequel television series Pennyworth, based on the Batman and V for Vendetta franchises, for Epix and HBO Max.

  26. Carlos Alvarado Quesada

    Carlos Alvarado Quesada
    Born in
    Costa Rica Flag Costa Rica
    Years
    1980-.. (age 45)
    Occupations
    journalistwriter
    Biography

    Carlos Andrés Alvarado Quesada is a Costa Rican politician, writer, journalist, and political scientist who served as the 48th president of Costa Rica from 8 May 2018 to 8 May 2022. A member of the Citizens' Action Party (PAC), Alvarado previously served as Minister of Labor and Social Security during the presidency of Luis Guillermo Solís.

  27. Raj Rajaratnam

    Raj Rajaratnam
    Born in
    Sri Lanka Flag Sri Lanka
    Years
    1957-.. (age 68)
    Occupations
    financierbanker
    Biography

    Rajakumaran Rajaratnam is a Sri Lankan-American former hedge fund manager and founder of the Galleon Group, a New York-based hedge fund management firm. He is also the author of his memoir, Uneven Justice: The Plot to Sink Galleon.

  28. Mohammad Shtayyeh

    Mohammad Shtayyeh
    Born in
    Palestine Flag Palestine
    Years
    1958-.. (age 67)
    Occupations
    writerpoliticianeconomist
    Biography

    Mohammad Ibrahim Shtayyeh is a Palestinian politician, academic, and economist who served as Prime Minister of the State of Palestine and the Palestinian National Authority from 2019 to 2024. On 26 February 2024, he and his government announced their resignation, remaining in office in a demissionary capacity until a new government was formed on 31 March 2024.

  29. Guy Standing

    Guy Standing
    Years
    1948-.. (age 77)
    Occupations
    university teachereconomistteacher
    Biography

    Guy Standing FAcSS is a British labour economist. He is a professor of development studies at the School of Oriental and African Studies, University of London, and a co-founder of the Basic Income Earth Network (BIEN). Standing has written widely in the areas of labour economics, labour market policy, unemployment, labour market flexibility, structural adjustment policies and social protection. He created the term precariat to describe an emerging class of workers who are harmed by low wages and poor job security as a consequence of globalisation. Since the 2011 publication of his book The Precariat: The New Dangerous Class, his work has focused on the precariat, unconditional basic income, deliberative democracy, and the commons.

  30. Andrew Morton

    Andrew Morton
    Born in
    United Kingdom Flag United Kingdom
    Years
    1953-.. (age 72)
    Occupations
    writerjournalistbiographer
    Biography

    Andrew David Morton is an English journalist and writer who has published biographies of royal figures such as Diana, Princess of Wales, and celebrity subjects including Tom Cruise, Madonna, Angelina Jolie and Monica Lewinsky; several of his books have been unauthorised and contain contested assertions.

  31. Norman Davies

    Norman Davies
    Born in
    United Kingdom Flag United Kingdom
    Years
    1939-.. (age 86)
    Enrolled in the University of Sussex
    In 1966 graduated with Master of Arts
    Occupations
    historianuniversity teacher
    Biography

    Ivor Norman Richard Davies CMG FBA FRHistS is a British and Polish historian, known for his publications on the history of Europe, Poland and the United Kingdom. He has a special interest in Central and Eastern Europe and is UNESCO Professor at the Jagiellonian University, professor emeritus at University College London, a visiting professor at the Collège d'Europe, and an honorary fellow at St Antony's College, Oxford. He was granted Polish citizenship in 2014.

  32. Euclid Tsakalotos

    Euclid Tsakalotos
    Born in
    Netherlands Flag Netherlands
    Years
    1960-.. (age 65)
    Occupations
    university teacherpoliticianeconomistphilosopher
    Biography

    Euclid Stefanou Tsakalotos is a Greek economist and politician who was Minister of Finance of Greece from 2015 to 2019. He was also a member of the Central Committee of Syriza and has represented Athens B in the Hellenic Parliament since May 2012. He left Syriza in November 2023 and on 5 December 2023 he became founding member of New Left (Greece) parliamentary group.

  33. Hélio Oiticica

    Hélio Oiticica
    Born in
    Brazil Flag Brazil
    Years
    1937-1980 (aged 43)
    Occupations
    draftspersonfilmmakerperformance artistpaintersculptor
    Biography

    Hélio Oiticica was a Brazilian visual artist, sculptor, painter, performance artist, and theorist best known for his participation in the Neo-Concrete Movement, for his innovative use of color, and for what he later termed "environmental art," which included Parangolés and Penetrables, like the famous Tropicália. Oiticica was also a filmmaker and writer.

  34. Jem

    Jem
    Born in
    United Kingdom Flag United Kingdom
    Years
    1975-.. (age 50)
    Occupations
    songwritersinger-songwriterrecording artistsinger
    Biography

    Jemma Gwynne Griffiths, known by her stage name Jem, is a Welsh singer, songwriter, and record producer.

  35. Owen Smith

    Owen Smith
    Born in
    United Kingdom Flag United Kingdom
    Years
    1970-.. (age 55)
    Occupations
    politicianjournalisttelevision producer
    Biography

    Owen Smith is a British lobbyist and former Labour Party politician. Smith was Member of Parliament (MP) for Pontypridd from 2010 to 2019.

  36. Guy Scott

    Guy Scott
    Born in
    Zambia Flag Zambia
    Years
    1944-.. (age 81)
    Occupations
    politicianeconomist
    Biography

    Guy Lindsay Scott is a Zambian politician, who served as acting President of Zambia from 2014 to 2015, and was the Vice President from 2011 to 2014.

  37. A. C. Grayling

    A. C. Grayling
    Born in
    Zambia Flag Zambia
    Years
    1949-.. (age 76)
    Occupations
    university teacherphilosopher
    Biography

    Anthony Clifford Grayling CBE FRSA FRSL is a British philosopher and author. He was born in Northern Rhodesia (now Zambia) and spent most of his childhood there and in Nyasaland (now Malawi). Until June 2011, he was Professor of Philosophy at Birkbeck, University of London, where he taught from 1991. In 2011 he founded and became the first Master of New College of the Humanities (now Northeastern University London), an independent undergraduate college in London. He is also a supernumerary fellow of St Anne's College, Oxford, where he formerly taught.

  38. Angela Barnes

    Angela Barnes
    Born in
    United Kingdom Flag United Kingdom
    Years
    1976-.. (age 49)
    Occupations
    stand-up comedianactorcomedian
    Biography

    Angela Barnes is an English stand-up comedian, mostly known for her appearances on Mock the Week.

  39. Michael Buerk

    Michael Buerk
    Born in
    United Kingdom Flag United Kingdom
    Years
    1946-.. (age 79)
    Occupations
    broadcasterjournalistnews presenter
    Biography

    Michael Duncan Buerk is a British journalist and newsreader. He presented BBC News from 1973 to 2002 and has been the host of BBC Radio 4's The Moral Maze since 1990. He was also the presenter of BBC One's docudrama 999 from 1992 to 2003. From 2017, Buerk also presented the TV programme Royal Recipes which ran for two series.

  40. Caroline Nokes

    Caroline Nokes
    Born in
    United Kingdom Flag United Kingdom
    Years
    1972-.. (age 53)
    Occupations
    politician
    Biography

    Caroline Fiona Ellen Nokes is a British Conservative Party politician who has been the Member of Parliament (MP) for Romsey and Southampton North since 2010. Elected as a Conservative, Nokes had the Conservative whip removed on 3 September 2019 and sat as an independent politician until the whip was restored to her on 29 October.

  41. John Cornforth

    John Cornforth
    Awards
    Nobel Prize in Chemistry in 1975
    Born in
    Australia Flag Australia
    Years
    1917-2013 (aged 96)
    Occupations
    university teacherchemist
    Biography

    Sir John Warcup Cornforth Jr., AC, CBE, FRS, FAA was an Australian–British chemist who won the Nobel Prize in Chemistry in 1975 for his work on the stereochemistry of enzyme-catalysed reactions, becoming the only Nobel laureate born in New South Wales.

  42. Peter Hain

    Peter Hain
    Born in
    Kenya Flag Kenya
    Years
    1950-.. (age 75)
    Occupations
    politician
    Biography

    Peter Gerald Hain, Baron Hain, PC, is a British politician who served as Secretary of State for Northern Ireland from 2005 to 2007, Secretary of State for Work and Pensions from 2007 to 2008 and twice as Secretary of State for Wales from 2002 to 2008 and from 2009 to 2010. A member of the Labour Party, he was Member of Parliament (MP) for Neath between 1991 and 2015.

  43. Marina Mahathir

    Marina Mahathir
    Born in
    Malaysia Flag Malaysia
    Years
    1957-.. (age 68)
    Occupations
    journalist
    Biography

    Datin Paduka Marina binti Tun Dr. Mahathir is a Malaysian socio-political activist and writer. She is the eldest child of the 4th and 7th Prime Minister of Malaysia, Mahathir Mohamad and Siti Hasmah Mohamad Ali. She graduated from the University of Sussex.

  44. Cosmo Sheldrake

    Cosmo Sheldrake
    Born in
    United Kingdom Flag United Kingdom
    Years
    1989-.. (age 36)
    Occupations
    musician
    Biography

    Cosmo Christopher Sheldrake is an English musician, composer, and producer. He is the son of parapsychologist Rupert Sheldrake and voice teacher Jill Purce, and the brother of mycologist Merlin Sheldrake. He released his first single, "The Moss"/"Solar", in 2014 and followed it up with the Pelicans We EP in 2015.

  45. Becky Anderson

    Becky Anderson
    Born in
    United Kingdom Flag United Kingdom
    Years
    1967-.. (age 58)
    Occupations
    journalisttelevision presenter
    Biography

    Rebecca Anderson is a British journalist and the anchor of CNN International's flagship news and current affairs primetime news program Connect the World. She previously hosted Business International.

  46. Josephine Wiggs

    Josephine Wiggs
    Years
    1965-.. (age 60)
    Occupations
    guitarist
    Biography

    Miranda Cordelia Susan Josephine Wiggs, simply known as Josephine Wiggs, is an English multi-instrumentalist rock musician, best known for her work as bassist in the alternative rock bands The Breeders and The Perfect Disaster. She has also formed multiple side-projects, including her own bands Honey Tongue, The Josephine Wiggs Experience, and Dusty Trails.

  47. Dermot Murnaghan

    Dermot Murnaghan
    Born in
    United Kingdom Flag United Kingdom
    Years
    1957-.. (age 68)
    Occupations
    presenterjournalisttelevision presenter
    Biography

    Dermot John Murnaghan is a British media personality, notable as a journalist, news reporter and television host. He has been a presenter for numerous networks including at Channel 4, a news presenter at CNBC Europe, Independent Television News and BBC News. He has presented news programmes in a variety of time slots since joining Sky News in 2007, until the end of February 2023.

  48. Brendan Foster

    Brendan Foster
    Born in
    United Kingdom Flag United Kingdom
    Years
    1948-.. (age 77)
    Occupations
    middle-distance runnerlong-distance runnermarathon runner
    Biography

    Sir Brendan Foster CBE is a British former long-distance runner, athletics commentator and road race organiser. He founded the Great North Run, one of the sport's most high profile half-marathon races. As an athlete, he won the bronze medal in the 10,000 metres at the 1976 Summer Olympics and the gold medal in the 5,000 metres at the 1974 European Championships and the 10,000 metres at the 1978 Commonwealth Games. He later provided commentary and analysis on athletics, particularly long-distance events, for BBC Sport.

  49. Heydon Prowse

    Heydon Prowse
    Born in
    United Kingdom Flag United Kingdom
    Years
    1981-.. (age 44)
    Occupations
    actorclimate activist
    Biography

    Heydon Prowse is a British activist, journalist, satirist, director and comedian. He is best known for writing and performing in BBC Three's Bafta-winning The Revolution Will Be Televised alongside Jolyon Rubinstein. As part of that show he gave George Osborne a GCSE maths text book, a stunt that featured on the front cover of The Daily Telegraph and other publications.

  50. Ben Bradshaw

    Ben Bradshaw
    Born in
    United Kingdom Flag United Kingdom
    Years
    1960-.. (age 65)
    Occupations
    politicianjournalistuniversity teacher
    Biography

    Sir Benjamin Peter James Bradshaw is a British politician who served as Secretary of State for Culture, Media and Sport from 2009 to 2010. A member of the Labour Party, he served as Member of Parliament (MP) for Exeter from 1997 to 2024. Before entering politics he worked as a BBC Radio reporter.

  51. Harry Kroto

    Harry Kroto
    Awards
    Nobel Prize in Chemistry in 1996
    Born in
    United Kingdom Flag United Kingdom
    Years
    1939-2016 (aged 77)
    Occupations
    university teacherchemistscientist
    Biography

    Sir Harold Walter Kroto was an English chemist. He shared the 1996 Nobel Prize in Chemistry with Robert Curl and Richard Smalley for their discovery of fullerenes. He was the recipient of many other honors and awards.

  52. Festus Mogae

    Festus Mogae
    Born in
    Botswana Flag Botswana
    Years
    1939-.. (age 86)
    Occupations
    politician
    Biography

    Festus Gontebanye Mogae is a Motswana politician and economist who served as the third President of Botswana from 1998 to 2008. He succeeded Quett Masire as President in 1998 and was re-elected in October 2004. After ten years in office, he stepped down in 2008 and was succeeded by Lieutenant General Seretse Khama Ian Khama.

  53. Kim Newman

    Kim Newman
    Born in
    United Kingdom Flag United Kingdom
    Years
    1959-.. (age 66)
    Occupations
    screenwriterwriterplaywrightnovelistscience fiction writer
    Biography

    Kim James Newman is an English journalist, film critic and fiction writer. He is interested in film history and horror fiction—both of which he attributes to seeing Tod Browning's Dracula at the age of eleven—and alternative history. He has won the Bram Stoker Award, the International Horror Guild Award and the BSFA award.

  54. Peter Kyle

    Peter Kyle
    Born in
    United Kingdom Flag United Kingdom
    Years
    1970-.. (age 55)
    Occupations
    politician
    Biography

    Peter John Kyle is a British politician who has served as Secretary of State for Science, Innovation and Technology since July 2024. A member of the Labour Party, he has been the Member of Parliament (MP) for Hove and Portslade, formerly Hove, since 2015. Kyle previously served as Shadow Minister for Victims and Youth Justice, Shadow Minister for Schools, and Shadow Northern Ireland Secretary.

  55. Sherry Rehman

    Sherry Rehman
    Born in
    Pakistan Flag Pakistan
    Years
    1960-.. (age 65)
    Occupations
    politicianjournalistdiplomat
    Biography

    Shehrbano "Sherry" Rehman is a Pakistani politician and journalist who has been the member of the Senate of Pakistan since 2015. She was the first female Leader of the Opposition in the Senate from March to August 2018 and served as Pakistan's Ambassador to the United States from 2011 to 2013. She is currently serving as the Federal Minister for the Ministry of Climate Change.

  56. Noureddine Melikechi

    Noureddine Melikechi
    Born in
    Algeria Flag Algeria
    Years
    1958-.. (age 67)
    Occupations
    physicistuniversity teacher
    Biography

    Noureddine Melikechi is an Algerian atomic, molecular, and optical physicist, educator and inventor. He is the author of more than 125 peer-reviewed publications, six book chapters and 15 patents. Melikechi is a member of the Mars Science Laboratory, NASA’s largest Mars exploration effort to date.

  57. Hattie Hayridge

    Hattie Hayridge
    Born in
    United Kingdom Flag United Kingdom
    Years
    1959-.. (age 66)
    Occupations
    film actorstand-up comedianactorcomedian
    Biography

    Hattie Hayridge is a British comedian and actress, best known for the role of the female version of Holly in Red Dwarf during the third, fourth and fifth series. She was described as a "cult figure in a beloved sit-com" by The List in 2007.

  58. Beardyman

    Beardyman
    Born in
    United Kingdom Flag United Kingdom
    Years
    1982-.. (age 43)
    Occupations
    vloggermusicianYouTuberbeatboxer
    Biography

    Darren Alexander Foreman, better known as Beardyman, is an English musical producer, DJ, multivocalist, musician and comedian from London known for his beatboxing skills and use of live looping.

  59. Alice Arnold

    Alice Arnold
    Born in
    United Kingdom Flag United Kingdom
    Years
    1962-.. (age 63)
    Occupations
    journalistactornews presenter
    Biography

    Alice Arnold is a British broadcaster and journalist. She was a newsreader and continuity announcer on BBC Radio 4 for more than twenty years until the end of December 2012. She currently works for Bauer Media Audio UK hosting on Mellow Magic.

  60. Zhang Xin

    Zhang Xin
    Born in
    China Flag China
    Years
    1965-.. (age 60)
    Enrolled in the University of Sussex
    Studied economics
    Occupations
    entrepreneurchief executive officer
    Biography

    Zhang Xin is a Chinese billionaire businesswoman, having primarily earned her fortune in the real estate industry. With her husband Pan Shiyi, she is the co-founder and former CEO of SOHO China, a Chinese office building developer. She stepped down from the role of CEO on 7 September 2022 “in order to focus on supporting the arts and philanthropic pursuits.” She has since taken on the role of Founder of Closer Media, a New York City-based film production company and financier.

  61. Jeremy Deller

    Jeremy Deller
    Born in
    United Kingdom Flag United Kingdom
    Years
    1966-.. (age 59)
    Occupations
    filmmakervideo artistperformance artistartist
    Biography

    Jeremy Deller is an English conceptual, video and installation artist. Much of Deller's work is collaborative; it has a strong political aspect, in the subjects dealt with and also the devaluation of artistic ego through the involvement of other people in the creative process. He won the Turner Prize in 2004 and represented Great Britain at the Venice Biennale in 2013.

  62. Catherine Mayer

    Catherine Mayer
    Born in
    United States Flag United States
    Years
    1961-.. (age 64)
    Occupations
    journalist
    Biography

    Catherine Mayer is an American-born British author and journalist, and the co-founder and President of the former Women's Equality Party (WE) in the UK.

  63. Anil Seth

    Anil Seth
    Born in
    United Kingdom Flag United Kingdom
    Years
    1972-.. (age 53)
    Enrolled in the University of Sussex
    In 2000 graduated with Doctor of Philosophy
    Occupations
    neuroscientistuniversity teacher
    Biography

    Anil Kumar Seth is a British neuroscientist and professor of Cognitive and Computational Neuroscience at the University of Sussex. A proponent of materialist explanations of consciousness, he is currently amongst the most cited scholars on the topics of neuroscience and cognitive science globally.

  64. Froyla Tzalam

    Froyla Tzalam
    Born in
    Belize Flag Belize
    Years
    1971-.. (age 54)
    Occupations
    anthropologistpolitician
    Biography

    Dame Froyla Tzalam GCMG is a Belizean Mopan Maya anthropologist and community leader, who has served as the third governor-general of Belize since 27 May 2021.

  65. Albie Sachs

    Albie Sachs
    Born in
    South Africa Flag South Africa
    Years
    1935-.. (age 90)
    Occupations
    university teacherwriterlawyerjudge
    Biography

    Albert "Albie" Louis Sachs OLS is a South African lawyer, activist, writer, and former judge appointed to the first Constitutional Court of South Africa by Nelson Mandela.

  66. Alan Woods

    Alan Woods
    Born in
    United Kingdom Flag United Kingdom
    Years
    1944-.. (age 81)
    Occupations
    journalistwriter
    Biography

    Alan Woods is a British Trotskyist political theorist and author. He is one of the leading members of the Revolutionary Communist International (RCI) and was a founder of Socialist Appeal (now the Revolutionary Communist Party). He is political editor of the RCI's In Defence of Marxism website. Woods was a leading supporter within the Militant tendency within the Labour Party and its parent group the Committee for a Workers' International until the early 1990s. A series of disagreements on tactics and theory led to Woods and Ted Grant leaving the CWI, to found the Committee for a Marxist International (soon renamed International Marxist Tendency) in 1992. They continued with the policy of entryism into the Labour Party. Woods has expressed particularly vocal support for the Bolivarian Revolution in Venezuela, and repeatedly met with the Venezuelan President Hugo Chávez, leading to speculation that he was a close political adviser to the president.

  67. Shamshad Akhtar

    Shamshad Akhtar
    Born in
    Pakistan Flag Pakistan
    Years
    1954-.. (age 71)
    Occupations
    bankereconomist
    Biography

    Shamshad Akhtar is a Pakistani development economist, United Nations diplomat, banker and politician who served as the caretaker finance minister of Pakistan from 2023 to 2024 as well as from 5 June 2018 to 18 August 2018.

  68. Ben Sidran

    Ben Sidran
    Born in
    United States Flag United States
    Years
    1943-.. (age 82)
    Enrolled in the University of Sussex
    In 1971 graduated with Doctor of Philosophy
    Occupations
    producertelevision presenternon-fiction writerradio personalityjazz pianist
    Biography

    Ben Hirsh Sidran is an American jazz and rock keyboardist, producer, label owner, and music writer. Early in his career he was a member of the Steve Miller Band and is the father of Grammy-nominated musician, composer and performer Leo Sidran.

  69. Kenan Malik

    Kenan Malik
    Born in
    India Flag India
    Years
    1960-.. (age 65)
    Occupations
    philosopherbiologistjournalistneuroscientist
    Biography

    Kenan Malik is a British writer, lecturer and broadcaster, trained in neurobiology and the history of science. As an academic author, his focus is on the philosophy of biology, and contemporary theories of multiculturalism, pluralism, and race. These topics are core concerns in The Meaning of Race (1996), Man, Beast and Zombie (2000) and Strange Fruit: Why Both Sides Are Wrong in the Race Debate (2008).

  70. Stuart Townend

    Stuart Townend
    Years
    1963-.. (age 62)
    Occupations
    singerhymnwritersongwriter
    Biography

    Stuart Townend is an English Christian worship leader and writer of hymns and contemporary worship music. His songs include "In Christ Alone", (2001, co-written with Keith Getty, Townend's first collaboration with any other songwriter), "How Deep The Father's Love For Us", "Beautiful Saviour" and "The King of Love". As of 2008, Christian Copyright Licensing International (CCLI) lists "In Christ Alone" in its Top 25 CCLI Songs list.

  71. Dimitri Nanopoulos

    Dimitri Nanopoulos
    Born in
    Greece Flag Greece
    Years
    1948-.. (age 77)
    Occupations
    physicistuniversity teachertheoretical physicist
    Biography

    Dimitri V. Nanopoulos is a Greek physicist. He is one of the most regularly cited researchers in the world, cited more than 48,500 times across a number of separate branches of science.

  72. John Gribbin

    John Gribbin
    Born in
    United Kingdom Flag United Kingdom
    Years
    1946-.. (age 79)
    Occupations
    astrophysicistwriterastronomernovelistscience fiction writer
    Biography

    John R. Gribbin is a British science writer, an astrophysicist, and a visiting fellow in astronomy at the University of Sussex. His writings include quantum physics, human evolution, climate change, global warming, the origins of the universe, and biographies of famous scientists. He also writes science fiction.

  73. Lucie Green

    Lucie Green
    Born in
    United Kingdom Flag United Kingdom
    Years
    1975-.. (age 50)
    Enrolled in the University of Sussex
    In 1998 graduated with master's degree
    Occupations
    astrophysicistastronomerphysicisttelevision presenter
    Biography

    Lucinda "Lucie" May Green is a British science communicator and solar physicist.

  74. Lai Shin-Yuan

    Lai Shin-Yuan
    Born in
    Taiwan Flag Taiwan
    Years
    1956-.. (age 69)
    Occupations
    university teacherpolitician
    Biography

    Lai Shin-yuan is a Taiwanese politician who served as minister of the Mainland Affairs Council from 2008 to 2012.

  75. Duncan Campbell

    Duncan Campbell
    Born in
    United Kingdom Flag United Kingdom
    Years
    1952-.. (age 73)
    Occupations
    television producerscreenwriterwriterinvestigative journalistuniversity teacher
    Biography

    Duncan Campbell FRSA is a British freelance investigative journalist, author, and television producer. Since 1975, he has specialised in the subjects of intelligence and security services, defence, policing, civil liberties and, latterly, computer forensics. He was a staff writer at the New Statesman from 1978 to 1991 and associate editor (Investigations) from 1988 to 1991. He was prosecuted under the Official Secrets Act in the ABC trial in 1978 and made the controversial series Secret Society for the BBC in 1987 (see Zircon affair). In 1988, he revealed the existence of the ECHELON surveillance program.

  76. Enele Sopoaga

    Enele Sopoaga
    Years
    1956-.. (age 69)
    Occupations
    diplomatpolitician
    Biography

    Enele Sosene Sopoaga PC is a Tuvaluan diplomat and politician who was Prime Minister of Tuvalu from 2013 to 2019.

  77. Ricardo Lagos Weber

    Ricardo Lagos Weber
    Born in
    United States Flag United States
    Years
    1962-.. (age 63)
    Occupations
    politicianeconomistlawyer
    Biography

    Ricardo Andrés Lagos Weber, son of former Chilean president Ricardo Lagos, is a politician who served as the Ministry General Secretariat of Government of Chile in the administration of former President Michelle Bachelet after having worked for Bachelet's 2005-2006 campaign. He is trained in law and economics, and has served the majority of his government career in economic positions. He was also an organizer and the senior representative for Chile at the Annual Meeting of APEC held in Chile in 2004, in addition to being one of the architects of the free trade agreements that Chile signed with the United States (United States-Chile Free Trade Agreement) and the European Union (European Union Association Agreement) as the head of the Foreign Ministry's Department of Trade Policy. He is a member of the Party for Democracy (PPD). Between March 2016 and March 2017 he was President of the Senate of Chile.

  78. Zoe Strimpel

    Zoe Strimpel
    Born in
    United Kingdom Flag United Kingdom
    Years
    1982-.. (age 43)
    Occupations
    journalist
    Biography

    Zoe Strimpel is a British columnist and commentator. Strimpel writes opinion columns for The Sunday Telegraph. She has appeared on BBC Radio 4's A Point Of View and presents a podcast on culture called Hyped! with the historian Tom Stammers.

  79. Dan Norris

    Dan Norris
    Born in
    United Kingdom Flag United Kingdom
    Years
    1960-.. (age 65)
    Occupations
    politician
    Biography

    Dan Norris is a British politician who has served as Mayor of the West of England since 2021. A member of the Labour Party, he has served as Member of Parliament (MP) for North East Somerset and Hanham since 2024, having represented Wansdyke, one of its predecessor constituencies, from 1997 to 2010.

  80. Clive Hamilton

    Clive Hamilton
    Years
    1953-.. (age 72)
    Enrolled in the University of Sussex
    Graduated with doctorate
    Occupations
    writereconomistprofessor
    Biography

    Clive Charles Hamilton AM FRSA is an Australian public intellectual currently serving as Professor of Public Ethics at the Centre for Applied Philosophy and Public Ethics (CAPPE) and the Vice-Chancellor's Chair in Public Ethics at Charles Sturt University. He is a member of the board of the Climate Change Authority of the Australian Government, and is the founder and former executive director of The Australia Institute. He regularly appears in the Australian media and contributes to public policy debates. Hamilton was granted the award of Member of the Order of Australia on 8 June 2009 for "service to public debate and policy development, particularly in the fields of climate change, sustainability and societal trends".

  81. Jayanthi Kuru-Utumpala

    Jayanthi Kuru-Utumpala
    Born in
    Sri Lanka Flag Sri Lanka
    Years
    1979-.. (age 46)
    Occupations
    women's rights activistmountaineer
    Biography

    Jayanthi Kuru-Utumpala is a Sri Lankan women’s rights activist with 20 years of experience and a rock climber / mountaineer for nearly as long. She has worked at national, regional, and global levels as a technical advisor, advocate, trainer, researcher, and program manager on issues relating to gender, gender-based violence, sexuality, masculinity, women’s human rights, and more recently, women in sports. In 2016, she became the first Sri Lankan to summit Mount Everest. In recognition of this achievement, from 2016-2019 she was appointed the Goodwill Ambassador for Women's Rights by the Sri Lankan Ministry of Women's Affairs. In 2017, she was also included in the BBC’s list of 100 inspiring and influential women from around the world. In 2023, she was the recipient of the International Olympic Committee’s Gender Equality, Diversity and Inclusion Champions Award for Asia (Olympic Council of Asia) (The National Olympic Committee of Sri Lanka (NOC SL)). Since returning from Everest, she has delivered over 500 motivational speeches, to schools, universities, clubs, professional sports teams, corporate entities, government, and non-governmental organizations, as well as the military and police. She is currently the Gender and Human Rights Advisor at the Family Planning Association in Sri Lanka, working to address stigma and discrimination faced by people seeking HIV services, and is a co-creator of ‘Delete Nothing’ – a local web-based initiative aimed at addressing online gender-based violence in Sri Lanka. Jayanthi serves on several boards and is the current Chairperson of the Women and Media Collective and the International Centre for Ethnic Studies. She is also a trustee of the ‘Women of the World Foundation’, a UK-based charity. Jayanthi holds an MA in Gender Studies from the University of Sussex (UK) and a post graduate diploma in Women’s Studies from the University of Colombo. For more details, find her on LinkedIn.

  82. Yannis Ragousis

    Yannis Ragousis
    Born in
    Greece Flag Greece
    Years
    1965-.. (age 60)
    Occupations
    politician
    Biography

    Giannis Ragousis is a Greek economist and politician of SYRIZA who had previously served in the government of Panhellenic Socialist Movement.

  83. Peter Jonas

    Peter Jonas
    Born in
    United Kingdom Flag United Kingdom
    Years
    1946-2020 (aged 74)
    Occupations
    theatre managerintendanttalent manager
    Biography

    Sir John Peter Jonas CBE FRCM FRSA was a British arts administrator and opera company director.

  84. Julie James

    Julie James
    Born in
    United Kingdom Flag United Kingdom
    Years
    1957-.. (age 68)
    Occupations
    politician
    Biography

    Julie James is a Welsh Labour politician currently serving as Counsel General and Minister for Delivery since September 2024. She has been the Member of the Senedd (MS) for Swansea West since 2011, and has served in the Welsh Government in various roles since 2018.

  85. Giles Ji Ungpakorn

    Giles Ji Ungpakorn
    Born in
    United Kingdom Flag United Kingdom
    Years
    1953-.. (age 72)
    Occupations
    historian
    Biography

    Associate Professor Giles Ji Ungpakorn is a Thai-British academic, and Marxist political activist. He formerly worked as a teacher at Chulalongkorn University. He worked as an associate professor in the Faculty of Political Science, Chulalongkorn University, before he fled to the United Kingdom in 2009 after facing a lèse majesté charge in Thailand.

  86. Mo Foster

    Mo Foster
    Born in
    United Kingdom Flag United Kingdom
    Years
    1944-2023 (aged 79)
    Occupations
    guitaristbassistsession musician
    Biography

    Michael Ralph "Mo" Foster was an English multi-instrumentalist, record producer, composer, solo artist, author, and public speaker. Through a career spanning over half a century, Foster toured, recorded, and performed with dozens of artists, including Jeff Beck, Gil Evans, Phil Collins, Ringo Starr, Joan Armatrading, Gerry Rafferty, Brian May, Scott Walker, Frida of ABBA, Cliff Richard, George Martin, Van Morrison, Dr John, Hank Marvin, Heaven 17,Véronique Sanson and the London Symphony Orchestra. He released several albums under his own name, authored a humorous book on the history of British rock guitar, written numerous articles for music publications, continued to compose production music, and established himself as a public speaker. Foster was an assessor for JAMES, an industry organisation that gives accreditation to music colleges throughout the United Kingdom. In 2014, Foster was a recipient of a BASCA Gold Badge Award to honour his lifelong contribution to the British songwriting and composing community.

  87. Helen Boaden

    Helen Boaden
    Born in
    United Kingdom Flag United Kingdom
    Years
    1956-.. (age 69)
    Occupations
    journalist
    Biography

    Helen Boaden is a British former broadcasting executive who spent more than 30 years working for the BBC, including as Director of Radio between February 2013 and September 2016.

  88. Srđa Trifković

    Srđa Trifković
    Born in
    Serbia Flag Serbia
    Years
    1954-.. (age 71)
    Enrolled in the University of Sussex
    In 1977 graduated with Bachelor of Arts in international relations
    Occupations
    writerjournalisthistorian
    Biography

    Srđa Trifković is a Serbian-American publicist, politician and historian. He is currently a foreign affairs editor for the paleoconservative magazine Chronicles, and a politics professor at the University of Banja Luka in Bosnia and Herzegovina.

  89. Simon Segars

    Simon Segars
    Born in
    United Kingdom Flag United Kingdom
    Years
    1967-.. (age 58)
    Occupations
    entrepreneurchief executive officer
    Biography

    Simon Anthony Segars FRS is a British business executive executive who was chief executive officer (CEO) of ARM Holdings plc from 2013 to 2022. ARM is the UK's largest semiconductor IP company headquartered in Cambridge, England, and was acquired by SoftBank Group for £24.3 billion in 2016.

  90. Suma Chakrabarti

    Suma Chakrabarti
    Born in
    India Flag India
    Years
    1959-.. (age 66)
    Occupations
    economist
    Biography

    Sir Sumantra "Suma" Chakrabarti KCB is a former British civil servant who served as president of the European Bank for Reconstruction and Development (EBRD) from July 2012 to July 2020. He was previously the highest ranking Indian in Britain's civil service, serving as Permanent Secretary to the Ministry of Justice and Clerk of the Crown in Chancery from late 2007 until 2012.

  91. Caroline Ansell

    Caroline Ansell
    Born in
    United Kingdom Flag United Kingdom
    Years
    1971-.. (age 54)
    Occupations
    politician
    Biography

    Caroline Julie Porte Ansell is a British Conservative Party politician who was the Member of Parliament (MP) for Eastbourne from 2019 to 2024. She was first elected at the 2015 general election, but was defeated at the snap 2017 general election.

  92. Dave Camp

    Dave Camp
    Born in
    United States Flag United States
    Years
    1953-.. (age 72)
    Enrolled in the University of Sussex
    Studied in 1973-1974
    Occupations
    employeepoliticianlawyer
    Biography

    David Lee Camp is a former American politician who served as a member of the United States House of Representatives from 1991 to 2015. Camp represented Michigan's 4th congressional district since 1993, and previously served one term representing Michigan's 10th congressional district. A member of the Republican Party, Camp was chairman of the House Committee on Ways and Means, serving from 2011 to 2015. In March 2014, he announced that he would not run for re-election.

  93. Rebeca Grynspan

    Rebeca Grynspan
    Born in
    Costa Rica Flag Costa Rica
    Years
    1955-.. (age 70)
    Occupations
    politicianeconomistlawyer
    Biography

    Rebeca Grynspan Mayufis is a Costa Rican economist who has been serving as Secretary-General of the UN Trade and Development (UNCTAD) since 13 September 2021.

  94. John M. Ball

    John M. Ball
    Born in
    United Kingdom Flag United Kingdom
    Years
    1948-.. (age 77)
    Enrolled in the University of Sussex
    1969-1972 graduated with Doctor of Philosophy
    Occupations
    mathematicianuniversity teacher
    Biography

    Sir John Macleod Ball is a British mathematician and former Sedleian Professor of Natural Philosophy at the University of Oxford. He was the president of the International Mathematical Union from 2003 to 2006 and a Fellow of Queen's College, Oxford.

  95. Mateusz Szczurek

    Mateusz Szczurek
    Born in
    Poland Flag Poland
    Years
    1975-.. (age 50)
    Occupations
    politicianuniversity teachereconomist
    Biography

    Mateusz Szczurek is a Polish economist and politician. He was the Polish Minister of Finance in the governments of successive prime ministers Donald Tusk and Ewa Kopacz from 2013 to 2015.

  96. Irene Solà

    Irene Solà
    Born in
    Spain Flag Spain
    Years
    1990-.. (age 35)
    Occupations
    writervisual artistpoet
    Biography

    Irene Solà Sáez is a Spanish writer and artist. She has exhibited her work at the CCCB in Barcelona and the Whitechapel Gallery in London. Her first book of poems, Bèstia won the 2012 Amadeu Oller Prize and her novel Els dics, the 2017 Documenta Prize.

  97. John Altman

    John Altman
    Born in
    United Kingdom Flag United Kingdom
    Years
    1949-.. (age 76)
    Occupations
    composerjazz musicianconductor
    Biography

    John Altman is an English film composer, music arranger, orchestrator and conductor.

  98. Howie Severino

    Howie Severino
    Born in
    Philippines Flag Philippines
    Years
    1961-.. (age 64)
    Occupations
    journalist
    Biography

    Horacio "Howie" Gorospe Severino is a Filipino broadcast journalist, anchor, host, documentarist and podcaster who is currently working in GMA Network, as consultant of GMA Integrated News, editor-at-large of GMA News Online, and is best known for hosting GMA Public Affairs' documentary program i-Witness.

  99. Simon Fanshawe

    Simon Fanshawe
    Born in
    United Kingdom Flag United Kingdom
    Years
    1956-.. (age 69)
    Occupations
    writer
    Biography

    Simon Hew Dalrymple Fanshawe OBE is an English writer, activist and broadcaster. He contributes frequently to British newspapers, television and radio. Fanshawe is also now a consultant and non-executive director of public and private organisations. He was one of the founders of the LGBT charity Stonewall, and won the Perrier Comedy Award in 1989. In 2019, Fanshawe became one of the supporters of the initiative that led to the formation of the LGB Alliance.

  100. Claudia Hammond

    Claudia Hammond
    Born in
    United Kingdom Flag United Kingdom
    Years
    1971-.. (age 54)
    Occupations
    psychologistjournalisttelevision presenterradio personalitywriter
    Biography

    Claudia Anne Hammond is a British author, frequent radio presenter and podcast host for BBC Radio 4 and the BBC World Service, and occasional TV presenter.